KEGG   Bacillus subtilis subsp. subtilis 168: BSU33570
Entry
BSU33570          CDS       T00010                                 

Symbol
yvaE
Name
(RefSeq) hypothetical protein
  KO
K03297  small multidrug resistance pump
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33570 (yvaE)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU33570 (yvaE)
SSDB
Motif
Pfam: Multi_Drug_Res EamA TMEM234 TMEM100 TgpA_N
Other DBs
NCBI-GeneID: 936156
NCBI-ProteinID: NP_391237
Pasteur: BG14061
BSORF: BG14061
UniProt: O32227 A0A6M3ZGD3
Position
complement(3448693..3449052)
AA seq 119 aa
MNWVFLCLAILFEVAGTVSMKLSSGFTKLIPSLLLIFFYGGSLFFLTLTLKSIDVSVAYA
VWSGMGIVLITVVGFLFFQEHVSVMKVISIGLIIAGVVSLNLIEHVAVSEPVHKSGQYK
NT seq 360 nt   +upstreamnt  +downstreamnt
atgaattgggtgtttctatgcttggcgattttgtttgaggttgcgggaactgtcagcatg
aagctatcgtctggttttacaaagcttattcccagtttgctgttgattttcttttatgga
gggagtcttttctttctgacgcttacgcttaaatccattgatgtatcagttgcttatgct
gtatggtcagggatgggaattgtcttgattacagtcgttggttttttgttttttcaagaa
catgtgagtgtcatgaaagtcatttcaattggattgattattgccggtgttgtgtcttta
aacctgatcgagcatgttgcggtgtctgagccggtacataaaagcgggcagtacaaatga

DBGET integrated database retrieval system