KEGG   Bacillus subtilis subsp. subtilis 168: BSU33580
Entry
BSU33580          CDS       T00010                                 

Symbol
yvaF
Name
(RefSeq) HTH-type transcriptional regulator YvaF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TetR_N TetR_C_9 HTH_Tnp_1_2 HTH_11 DUF4315 DUF5388 MerR_1 Glycoprot_B_PH2
Other DBs
NCBI-GeneID: 936128
NCBI-ProteinID: NP_391238
Pasteur: BG14062
BSORF: BG14062
UniProt: O32228 A0A6M3ZGA8
Position
complement(3449049..3449621)
AA seq 190 aa
MDKRILAETFRLIKQKGFSFTMNDLAAALGTSKRTLYAYYSSKDQLVEAVVEQFIAEMKQ
IERDIYENESLNVLEKVKQMLISLPQGMELLNMGLLNELKKYHYDAWLTLDAFIKEEWAI
VLALLNECKQQKRIRNINPDLFVHMYIGSINQVYDPEYPLKHQFTTGEVLESIVDVLFNG
ITADEEADAT
NT seq 573 nt   +upstreamnt  +downstreamnt
atggataaaagaattctggcggaaaccttccggctgatcaagcagaaaggattttcattt
acgatgaatgatttggcggcagcgctgggaacgagcaagcggacgctctatgcatattat
tcatctaaagatcagcttgttgaggcggttgtcgaacaatttatagctgaaatgaagcaa
atagaaagagacatctatgaaaatgaaagtttaaatgtgctcgaaaaggtgaaacaaatg
ctgatcagccttccgcaggggatggaactgctgaacatgggattattaaatgaactaaag
aaataccattacgatgcgtggcttacattagacgcgtttattaaggaagaatgggcgatt
gtcctagcattattaaatgagtgcaaacagcaaaagagaatcagaaacatcaatccggac
ctgtttgttcacatgtatatagggagcatcaatcaagtgtatgaccctgaatatccgctg
aaacatcagttcacgacaggagaggtacttgaatcaattgtagatgttttgtttaacggt
ataacagctgatgaggaggctgatgccacatga

DBGET integrated database retrieval system