KEGG   Bacillus subtilis subsp. subtilis 168: BSU33590
Entry
BSU33590          CDS       T00010                                 

Symbol
yvaG
Name
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Polysacc_synt_2 THF_DHG_CYH_C Shikimate_DH F420_oxidored
Other DBs
NCBI-GeneID: 936172
NCBI-ProteinID: NP_391239
Pasteur: BG14063
BSORF: BG14063
UniProt: O32229 A0A6M4JP76
Position
complement(3449732..3450526)
AA seq 264 aa
MKLNLQGKTALVTGSTSGIGKAIASSLAEEGAAVIINGRREEKVNQTIDELKTQHAEAVL
YPAAFDLGTEEGCNELFQAYPEVDILVNNLGIFEPAEYFDIPDDEWFRFFEVNIMSGVRL
TRRYLHNMIEKKEGRVIFIASEAAIMPSQEMAHYSATKTMQLSISRSLAELATGTNVTVN
TVMPGSTLTEGVETMLNSLYPGENLTVQEAEARFMKENRPTSIIQRLIRPEEIAHFVTFL
SSPLSSAINGAALRADGGLVRSVF
NT seq 795 nt   +upstreamnt  +downstreamnt
atgaagctgaatttacaaggaaaaaccgcactggtgaccggttcgacatcagggatcgga
aaagctattgcctcttcgttagctgaagaaggtgcggcagtgatcattaacggacgccgg
gaagagaaagtgaatcaaacgatagatgaactgaaaacacaacatgctgaagcggttctt
tatccggctgcatttgatttgggaacagaagaaggctgcaatgagctgtttcaggcatat
ccagaggttgatattttggtcaacaatttagggatttttgaaccggcggagtactttgat
attcccgacgatgaatggtttcgtttttttgaagtgaatattatgagcggtgtaaggctg
acacgcaggtatttgcataacatgatagagaaaaaagaagggcgtgtgattttcattgcc
agtgaagcggcgattatgccgtcacaggaaatggcccattacagtgcgacaaaaacgatg
cagctgtccatttcccgcagtttggcggagctggcaaccggcacgaatgtcacagtcaac
accgtcatgccgggctctaccttaacagagggtgtggaaaccatgctgaactcgctgtat
cctggtgaaaacctgactgttcaagaagctgaggcacgttttatgaaagaaaaccggccg
acatctattattcaaagactgatccgtccggaagaaatcgcccacttcgttacattttta
agcagtccgctttcctctgcgatcaatggcgcggcacttcgggcggacggcggtttggtc
cgcagtgtcttttaa

DBGET integrated database retrieval system