KEGG   Bacillus subtilis subsp. subtilis 168: BSU33600
Entry
BSU33600          CDS       T00010                                 

Gene name
smpB
Definition
(RefSeq) SsrA-binding protein
  KO
K03664  SsrA-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    BSU33600 (smpB)
SSDB
Motif
Pfam: SmpB
Other DBs
NCBI-GeneID: 936170
NCBI-ProteinID: NP_391240
Pasteur: BG14064
BSORF: BG14064
UniProt: O32230
Position
complement(3451248..3451718)
AA seq 156 aa
MPKGSGKVLSQNKKANHDYFIEETYETGIVLQGTEIKSIRAGRVNLKDSFAKIERGEVFL
HNMHVSPYEQGNRYNHDPLRTRKLLMHRKEINKLIGLTKEKGYSLVPLKLYLKNGFAKVL
LGLGKGKKNYDKREDLKRKDAKREIERAFRDSQKGF
NT seq 471 nt   +upstreamnt  +downstreamnt
atgccaaaagggtcaggaaaagtattatctcaaaataagaaagccaaccacgattatttt
atagaagaaacctatgaaacaggcatcgttctgcaaggaaccgaaatcaaatcgattcgc
gccggccgcgtaaaccttaaggattccttcgccaaaatcgaacggggagaagtgtttctc
cacaatatgcacgtcagcccatatgagcagggaaaccgctataaccacgatccgctccgg
acaagaaagctgttaatgcaccgcaaggagattaataagctgatcgggttaacaaaggaa
aaaggctattctctcgttccgctgaagctgtatttaaaaaacggctttgccaaagtgctt
ctcggccttggaaaagggaagaagaactatgacaaacgggaagatctgaagcgcaaggac
gcgaagcgggaaatcgaaagagcgttcagagacagtcaaaaaggcttctaa

DBGET integrated database retrieval system