KEGG   Bacillus subtilis subsp. subtilis 168: BSU33680
Entry
BSU33680          CDS       T00010                                 

Symbol
yvaP
Name
(RefSeq) HTH-type transcriptional regulator YvaP
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HxlR PadR DUF505 HTH_45
Other DBs
NCBI-GeneID: 938478
NCBI-ProteinID: NP_391248
Pasteur: BG14071
BSORF: BG14071
UniProt: O32238 A0A6M3ZGB6
Position
3457615..3457941
AA seq 108 aa
MNQSEMCPRFEKAVDILSKRWVALIVFQLLNGSQRFSEIEAALPNLSGRVLSERLKELEL
EGVVKRDVIPETPVRIEYSLTDKGKALAPILGEISKWATEWIDPSFLD
NT seq 327 nt   +upstreamnt  +downstreamnt
atgaaccaatcagaaatgtgtcctagatttgaaaaagcagtcgacatcttaagtaaacgc
tgggtcgctttaatcgtatttcagctcttgaacgggtcgcagcgatttagcgaaattgaa
gcagcacttccaaatctaagcggcagagttctgtcagaacggctgaaagaacttgagctt
gaaggagtagtgaagcgggatgtcatccctgaaactccggttcgcatcgaatattcattg
actgataaaggaaaggcactagcacccatattaggtgagatttctaaatgggcgactgaa
tggattgacccttcctttcttgactaa

DBGET integrated database retrieval system