KEGG   Bacillus subtilis subsp. subtilis 168: BSU33690
Entry
BSU33690          CDS       T00010                                 

Symbol
yvaQ
Name
(RefSeq) sensory transducer protein YvaQ
  KO
K03406  methyl-accepting chemotaxis protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU33690 (yvaQ)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU33690 (yvaQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU33690 (yvaQ)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    BSU33690 (yvaQ)
SSDB
Motif
Pfam: MCPsignal 4HB_MCP_1 HAMP TarH TMP_3 Laminin_II DUF948 CHASE3 CdvA DUF5304 MLD EzrA Mce4_CUP1
Other DBs
NCBI-GeneID: 938479
NCBI-ProteinID: NP_391249
Pasteur: BG14072
BSORF: BG14072
UniProt: O32239 A0A6M3ZJE1
Position
3458066..3459766
AA seq 566 aa
MRLTISRKFSLVFLTLILINLLVGGIGVLNMQHIIQKTDEINTKWIDGIKGITSINYVTE
HLSSKEKDFLIYTDKSKMDTLDQEMNQIMEDINQKLDNYEKTISTDKEQKLFEQLQTKVN
TYMDIHAQIIESGRTNDMDKARGLLVQTEASFEDMKKTITQLVDLNQEGSNTAVKETKAV
YHKGLIYTALLVAASILISIFIWLYITRNIVKPIIRMKESANHIAEGDLSNDMEALNSKD
ELGDLNEALQKMVGNLRDIVGYSKDISSRVLSSSQVLATATNETRSGSKHITETMNEMAE
GSEQQAQDAVTIAESMNEFTESIDKAYNHGITISDTSQNVLELAVSGNENMATSLQQMKT
IHHIVEEAVHKVRSLEQHSQDINKLVQVINGIAEQTNLLSLNAAIEAARAGESGKGFAVV
AEEVRKLADGVSDSVQDITRIVNGTQQEIHTVITYLESSFTEVEKGTENLTDTGQAMQHI
KQSVTHVADSIKEVTDGLKQLTNQSITINQSIENIASVSEESAAGIEETFSITEQSAHSM
DQVLLNAEELEQLANELNEKMGQFTI
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgcgactgacgatttcccgcaaattcagcctggtatttttgacactgatcctgatcaat
ttacttgtaggcggaataggcgttcttaatatgcagcatatcattcaaaaaacagatgaa
atcaacacaaaatggattgacggcatcaaaggaatcacttcaattaattatgtaaccgag
cacctgtcttctaaagaaaaggactttctgatttatacagacaaaagtaaaatggataca
cttgatcaagaaatgaatcaaatcatggaagacattaaccaaaagctcgataactacgaa
aaaacgatctccactgataaagagcagaaactgttcgagcagcttcaaactaaagtgaat
acctatatggatattcatgcgcaaattatcgaaagcggccgcacgaatgacatggacaaa
gcaagaggtttattggttcagactgaggccagctttgaggatatgaaaaaaacaatcact
cagcttgttgacttaaatcaagaaggcagcaacacagcggtaaaagaaacgaaggccgtc
tatcataaagggctcatttacactgctttgcttgtggcagcatcaatcctcatcagcatt
ttcatctggctttatatcacgcgaaacattgtaaagcctatcattcgcatgaaggaatct
gccaatcatattgccgaaggcgatttgtcgaacgatatggaggccctcaactcaaaagac
gagctgggtgatctgaatgaagcgctgcaaaaaatggtagggaatctgagagatattgtc
ggatattctaaagacatatcaagccgggttctttcttcttcacaggtgcttgcaaccgca
acgaatgaaacaagatccggcagcaaacatattaccgagacgatgaacgaaatggctgag
ggctctgaacagcaggcccaagacgcggtgacgattgccgaatcgatgaatgagtttacc
gaaagcattgataaagcctataatcacggcatcacaatcagcgatacgtctcaaaacgtt
ctcgaactcgcggtaagcgggaacgaaaatatggctacgtcattacagcaaatgaaaacc
atccatcatattgttgaagaagccgtgcataaagtgagatcactggaacagcattctcag
gatattaacaagctcgttcaggtcatcaacgggattgccgagcagacgaatttgctgtcc
cttaacgccgcgattgaagctgcccgcgctggagaaagcggcaaaggcttcgccgttgtg
gcagaggaggtcagaaagctggctgacggcgtttctgattccgtgcaggacattacccgg
attgtaaacgggacacagcaggagatccacactgtcattacgtacttggaaagcagcttt
acagaagtcgaaaaaggaacggaaaacctgacagacaccggacaggctatgcagcatatc
aaacaatccgtcacccatgttgcagacagcattaaggaagtaacggatggcttgaagcag
ttaacaaaccaatcgattaccatcaatcaatcgattgaaaatatcgcttctgtatccgaa
gagtctgccgccggcattgaagaaacattttcaattaccgagcaatccgcccattcgatg
gatcaagtgcttctaaatgctgaagagcttgagcagctggccaatgagcttaatgagaag
atgggtcagtttacgatttaa

DBGET integrated database retrieval system