KEGG   Bacillus subtilis subsp. subtilis 168: BSU33700
Entry
BSU33700          CDS       T00010                                 

Symbol
opuBD
Name
(RefSeq) choline transport system permease protein OpuBD
  KO
K05846  osmoprotectant transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU33700 (opuBD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33700 (opuBD)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Osmoprotectant transporter
    BSU33700 (opuBD)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 936226
NCBI-ProteinID: NP_391250
Pasteur: BG12636
BSORF: BG12636
UniProt: P39775 A0A6M3ZGP8
Position
complement(3459806..3460486)
AA seq 226 aa
MNVLEQLMTYYAQNGSYVMDEFGRHFLMSAYGVLFAAVVGVPAGILIAHFRRLSAWVFAV
TNVIQTIPALAMLAVLMLVMGLGANTVILSLFLYSLLPIIRNTYTGIISIEHAYLESGKA
MGMTKFQVLRMVELPLALSVIMAGLRTALVIAIGITAIGTFVGAGGLGDMIVRGSNATNG
TAIILAGAIPTAVMAVGADLLMAWLERALSPVKKKRTGAKHVQSAA
NT seq 681 nt   +upstreamnt  +downstreamnt
atgaacgtgcttgaacagttaatgacgtattacgcgcagaatggcagttacgtcatggat
gaattcggccgccactttctcatgtcggcttacggcgttttatttgccgctgtcgtcggg
gttccggccggaatcctcatcgcgcattttcgccgtttgtcagcctgggtgtttgccgta
acaaacgttattcaaacaatcccggcgctcgctatgctggccgtcttaatgcttgttatg
gggctcggcgcaaataccgtgattctatcattatttctgtattccctgctgccgattatt
cgaaacacgtacacaggcattatcagtattgaacatgcctacttagaatctggaaaagca
atgggcatgacgaaattccaagtgctcagaatggttgagctcccgctcgcactttctgtc
attatggcgggccttcgcacggctctcgtcattgccatcggaattacagcgatcggcaca
tttgtcggtgccggaggccttggggacatgatcgtacgcggctcaaacgcaacaaacgga
actgcgattattctagccggagcgataccaactgcggtgatggcggtaggggcggatttg
ctcatggcttggctggagcgggcattaagtccggtgaagaaaaaaagaaccggggcgaaa
catgttcaatcagctgcatag

DBGET integrated database retrieval system