KEGG   Bacillus subtilis subsp. subtilis 168: BSU33710
Entry
BSU33710          CDS       T00010                                 

Symbol
opuBC
Name
(RefSeq) choline-binding protein
  KO
K05845  osmoprotectant transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU33710 (opuBC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33710 (opuBC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Osmoprotectant transporter
    BSU33710 (opuBC)
SSDB
Motif
Pfam: OpuAC
Other DBs
NCBI-GeneID: 938475
NCBI-ProteinID: NP_391251
Pasteur: BG12635
BSORF: BG12635
UniProt: Q45462 A0A6M3ZKV4
Structure
Position
complement(3460503..3461423)
AA seq 306 aa
MKRKYLKLMIGLALAATLTLSGCSLPGLSAAADQTIKIGAQSMSESEIIASMLGQLIEHH
TDLKTTTIKNLGSNAVQQQALMNGEIDIAATRYTGDALTGTLRMEPEKDPDKALALTQRE
FKKRYDLKWYDSYGFDNTYAFTVSKELADQYHLETVSDVKKWAPQLKLGVDNYWMKLKGN
GYQDFTKTYGMTFGGTYPMQIGLVYDAVKSGKMDIVLAYSTDGRIKSYGLKMLKDDKQFF
PPYDCSPVVPEKVLKEHPELEGIIKKMLGKIDTATMQELNYEVDGNLKEPSVVAKEYLEK
HRYFES
NT seq 921 nt   +upstreamnt  +downstreamnt
atgaaaagaaaatatctcaaattaatgataggtttagcacttgcggcaacgctgacgctg
agcggctgttcgcttcctggtctcagcgctgctgcagaccagaccattaaaatcggcgcg
caaagcatgagcgaatcagaaatcatcgccagcatgcttggccagttgatcgaacaccat
actgatctcaaaacaacaacgattaaaaatcttggctccaacgcggtgcagcagcaggct
ttaatgaacggggaaatcgacattgcggccacaagatatacgggagacgcgctgacaggc
acgttgagaatggaacctgaaaaagatccggacaaagcgctggcgcttactcagcgggag
tttaaaaaaagatatgatttaaagtggtatgactcctacgggtttgataatacatatgcc
tttacagtcagcaaggagctggccgaccaataccatttagagaccgtatcagacgttaaa
aaatgggcgccgcaattaaagctgggcgttgataactattggatgaagctcaaaggaaac
ggctatcaggattttacgaaaacctacggcatgacattcggcggcacgtatccgatgcag
atcggccttgtgtacgacgcggtgaaaagcggaaaaatggacattgtgcttgcgtattca
accgatggaagaatcaagtcctatggtctcaaaatgctaaaggatgataaacaatttttc
ccgccgtacgactgctctccggttgttccggaaaaggtgctcaaagaacatcctgaactt
gaaggcatcatcaagaaaatgctcggaaaaatcgacacagccacgatgcaggagcttaac
tatgaagtcgacggcaatctcaaagaaccgtctgtcgttgccaaggaatatttagaaaaa
catcgctatttcgaatcgtga

DBGET integrated database retrieval system