KEGG   Bacillus subtilis subsp. subtilis 168: BSU33720
Entry
BSU33720          CDS       T00010                                 

Symbol
opuBB
Name
(RefSeq) choline transport system permease protein OpuBB
  KO
K05846  osmoprotectant transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU33720 (opuBB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33720 (opuBB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Osmoprotectant transporter
    BSU33720 (opuBB)
SSDB
Motif
Pfam: BPD_transp_1 ABC2_membrane_3 DUF2929
Other DBs
NCBI-GeneID: 936225
NCBI-ProteinID: NP_391252
Pasteur: BG12634
BSORF: BG12634
UniProt: Q45461 A0A6M3ZH04
Position
complement(3461435..3462088)
AA seq 217 aa
MHHIVQFLQTNGGELLYKTYEHITISLIAVILGVLVAVPLGVVLTRMKKGAGTIIGIVNI
IQTLPSLAILAFFIPLLGVGKVPAIVALFFYSVLPILRNTYTGIRGVNKNLLESGKGIGM
TPAEQVRLVELPLAAPVIMAGIRTSTIYLIGWATLASFIGGGGLGDYIFIGLNLYQPEYI
IGGAVPVTILAIVIDYVLAVAERKLTPAGMQRLKELS
NT seq 654 nt   +upstreamnt  +downstreamnt
atgcatcatattgttcaatttttgcaaaccaatgggggagagcttctttataaaacatac
gagcatattacgatatcgctcattgctgtgatcttaggtgtgctggttgccgtccccctc
ggggttgtgcttaccagaatgaaaaaaggagccggcaccattatcggcattgtcaatatc
attcagacgctgccgagtctggccatcctcgctttttttatcccgctccttggtgtaggg
aaggttccggccattgtggctttgtttttctattccgtattgccgattcttcgcaacacg
tataccggcattcgcggcgtcaacaaaaatctgctcgagtctggtaaaggaataggaatg
acgccggctgaacaagtccgcttggtggagctgccgcttgccgcaccagtgatcatggcg
ggaatcagaacatcgacgatttacttaatcggctgggccacgcttgcttcctttatcgga
ggcggcggattgggtgattacatttttatcggactgaatttatatcagccggaatatatc
atcgggggcgcggtacctgtcacgatattggcaattgtgattgattatgtgctggcagtt
gctgaacgaaaactgacacctgccggcatgcagagattgaaggaattgtcataa

DBGET integrated database retrieval system