KEGG   Bacillus subtilis subsp. subtilis 168: BSU33740
Entry
BSU33740          CDS       T00010                                 

Symbol
yvaV
Name
(RefSeq) HTH-type transcriptional regulator YvaV
  KO
K22301  HTH-type transcriptional regulator, osmoprotectant uptake regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU33740 (yvaV)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    BSU33740 (yvaV)
SSDB
Motif
Pfam: MarR_2 TrmB HTH_IclR HTH_5 MarR HTH_24 Dopey_N HTH_27 SMC_ScpB KORA Baculo_E25 HTH_Crp_2 HTH_26 HTH_20 rve_3 HTH_35 DUF6262
Other DBs
NCBI-GeneID: 936233
NCBI-ProteinID: NP_391254
Pasteur: BG14073
BSORF: BG14073
UniProt: C0SPB8 A0A6M3ZGN8
Position
3463534..3464067
AA seq 177 aa
MEKDPLTIIEQAEDHFIERIAENMHAFGMPSTVGRVLGIIYMNRKPMTLTELSEATGMSK
TRMSQVVREMLDANIAEKVFEKGVRKDLYEVEQDYYQTFITLFSATWSKVVSKNKMMHKK
LNRELLSVLDEELTPEAEEKVNELLKELKEWLDYYNWLSRLIEFFESEDIFKYVPKP
NT seq 534 nt   +upstreamnt  +downstreamnt
ttggagaaagatccgttaacgatcattgaacaagccgaggaccattttatagaaagaatc
gcggaaaacatgcatgcatttggaatgccctctaccgtcggacgagtgctgggcattatt
tatatgaatcgaaaaccgatgacgcttacggaattatctgaggccaccggcatgagtaaa
acacgtatgagccaggtagtgcgggaaatgcttgatgccaacattgccgagaaggtattc
gaaaaaggcgtgcgaaaagatttatatgaggttgagcaggactactatcaaacatttatc
acgctgttttcagccacctggagcaaagtcgtcagcaaaaacaaaatgatgcataaaaaa
ctcaatcgggagctgcttagcgtgttggatgaagagcttactcctgaagcggaagaaaaa
gtgaatgagctgctgaaggaattaaaggaatggctcgattattataattggctcagccgt
ttgattgagttttttgagagcgaagacatttttaaatatgtgccgaagccgtaa

DBGET integrated database retrieval system