KEGG   Bacillus subtilis subsp. subtilis 168: BSU33750
Entry
BSU33750          CDS       T00010                                 

Symbol
sdpA
Name
(RefSeq) sporulation-delaying protein SdpA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SdpA
Other DBs
NCBI-GeneID: 938629
NCBI-ProteinID: NP_391255
Pasteur: BG14074
BSORF: BG14074
UniProt: O34889 A0A6M3ZGP5
Position
3464289..3464765
AA seq 158 aa
MTICFLLFSSYYFSNISPQNPLFKKNFLQQLSPQGFGFYSKSPTEENISFHTKENLKLPN
ALPNNFFGIKREGRVQAIELGKIVENIDPKNWKTCENNNSCTNLEKQIKPIKVIKNEDYI
HLSKGEYLIYRQKPLSWYWIDFKQTTSFERKVLKIKIV
NT seq 477 nt   +upstreamnt  +downstreamnt
atgactatatgtttcctattattttcttcttattactttagcaatatttcacctcagaat
ccactgttcaaaaaaaattttttgcaacaattgtctccccaaggctttggcttttatagt
aaaagccctacagaagaaaacatttcatttcacacaaaagaaaatttaaagttacctaat
gcacttcccaataatttttttgggataaaaagagaaggaagagttcaggcaatagaatta
ggcaaaattgtagagaatatcgatccaaagaattggaaaacttgtgaaaacaacaactcc
tgcacaaatttagagaaacaaataaagcctattaaggttataaaaaatgaagattatata
catcttagcaaaggagaatacctaatatatcgccaaaaaccactctcatggtattggata
gactttaagcaaactacctcttttgaaagaaaggtgctaaaaataaaaatagtatga

DBGET integrated database retrieval system