KEGG   Bacillus subtilis subsp. subtilis 168: BSU33770
Entry
BSU33770          CDS       T00010                                 

Symbol
spbC
Name
(RefSeq) killing factor SdpC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Nairo_nucleo RNase_E_G MscS_TM
Other DBs
NCBI-GeneID: 936227
NCBI-ProteinID: NP_391257
Pasteur: BG14076
BSORF: BG14076
UniProt: O34344 A0A6M4JP93
Position
3465776..3466387
AA seq 203 aa
MKSKLLRLLIVSMVTILVFSLVGLSKESSTSAKENHTFSGEDYFRGLLFGQGEVGKLISN
DLDPKLVKEANSTEGKKLVNDVVKFIKKDQPQYMDELKQSIDSKDPKKLIENMTKADQLI
QKYAKKNENVKYSSNKVTPSCGLYAVCVAAGYLYVVGVNAVALQTAAAVTTAVWKYVAKY
SSSASNNSDLEAAAAKTLKLIHQ
NT seq 612 nt   +upstreamnt  +downstreamnt
ttgaaaagtaaattacttaggctattgattgtttccatggtaacgatattggttttttca
ttagtaggactctctaaggagtcaagtacatctgctaaagaaaaccatacattttctgga
gaagattactttagaggacttttatttggacaaggggaagttggtaaattaatttcaaac
gatttggaccctaaactcgtaaaagaggcaaatagtacagaaggtaaaaagttagtaaat
gatgtagtcaaatttataaaaaaagatcaaccacaatatatggatgaattgaaacaatcg
attgacagcaaagaccctaaaaaactcattgaaaatatgaccaaagcagaccaacttatc
caaaaatatgctaagaaaaatgaaaacgtaaaatactcttctaataaagttactccatct
tgtgggctttatgccgtctgtgtagcagctggatatttatatgttgtgggcgttaacgca
gttgcattacaaacggctgccgcagtaacaactgcagtgtggaaatacgttgccaaatat
tcctcttcagcttctaataattctgatttagaagcggctgctgcaaaaaccctaaaattg
attcatcaataa

DBGET integrated database retrieval system