KEGG   Bacillus subtilis subsp. subtilis 168: BSU33780
Entry
BSU33780          CDS       T00010                                 

Symbol
sdpI
Name
(RefSeq) immunity protein SdpI
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SdpI DUF1648 DUF4229 DUF5313 Per1 Trep_Strep
Other DBs
NCBI-GeneID: 936238
NCBI-ProteinID: NP_391258
Pasteur: BG14077
BSORF: BG14077
UniProt: O32241 A0A6M3ZGC3
Position
complement(3466434..3467057)
AA seq 207 aa
MKKNIISIIIVCLSFLTSIILYQYLPEEIPIQWSGNKPAAIVSKPLTIFIIPVVMLIYYL
TFYMLTIKSTQKNKALLFLASNNMLILLYILQLSTLLISLGYEVNIDLIIGLGVGIFLII
GGNSMQLAEQNHLIGLRTPWTLKDETVWKLGNRFASKVLVVCGFIIAVLSFFTGEYIILI
MIVLVLLALVISTLASYHYYKKLNGSR
NT seq 624 nt   +upstreamnt  +downstreamnt
atgaagaaaaatataatttccataattattgtatgtttgagtttcttgacttcaattata
ttatatcaataccttccagaagaaataccgatacaatggtcaggaaataaaccggctgca
attgtatctaaacctttaacaatatttattatacctgttgttatgcttatttattatctt
actttttatatgttaactattaagtctacacaaaaaaataaagcattgcttttcctagct
tctaataatatgttaatccttttatatattttacaactctcaactctattgataagttta
ggatacgaagtgaatattgatttaataatagggcttggtgttggtatctttttaattatt
ggtggaaattctatgcagctagcagaacaaaaccatcttattggattgaggacaccttgg
acattaaaagatgagactgtttggaaactgggaaatcgctttgcctctaaagtacttgta
gtgtgtggttttataatagctgttctttcattttttacaggagaatatataattcttatt
atgattgtgctagttcttctagcattagttatttcaacactagcttcatatcattattac
aaaaaattaaacggttcacgttga

DBGET integrated database retrieval system