KEGG   Bacillus subtilis subsp. subtilis 168: BSU33790
Entry
BSU33790          CDS       T00010                                 

Symbol
sdpR
Name
(RefSeq) transcriptional repressor SdpR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_5 HTH_20 HTH_24 MarR_2 TrmB HTH_11 HTH_Crp_2 HTH_28 MarR HTH_10 HTH_7 Sigma70_r4 TFIIE_alpha DUF4423 HTH_37 Rrf2 HTH_IclR Sigma70_r4_2 Fe_dep_repress UPF0122 HTH_DeoR ArsR PuR_N HTH_38 HTH_23 NUMOD1 TetR_N
Other DBs
NCBI-GeneID: 936249
NCBI-ProteinID: NP_391259
Pasteur: BG14078
BSORF: BG14078
UniProt: O32242 A0A6M4JP94
Position
complement(3467054..3467326)
AA seq 90 aa
MNNVFKAISDPTRRKILDLLKGGDMTAGDIAEHFNISKPSISHHLNILKQAEVISDHRKG
QFIYYSLNTTVLQDSINWMLNFINKGDNDL
NT seq 273 nt   +upstreamnt  +downstreamnt
atgaataatgttttcaaagctatatcagatccaacaaggagaaaaattttggatttgtta
aaaggaggggatatgactgcgggagatattgctgagcattttaatatcagcaaaccgagt
atttcgcaccacttgaatattttaaagcaagcggaagtcataagtgaccatcgcaaagga
caatttatttattactctctaaatacaacagtacttcaagactcaataaattggatgctt
aactttataaataaaggggataacgatttatga

DBGET integrated database retrieval system