KEGG   Bacillus subtilis subsp. subtilis 168: BSU33800
Entry
BSU33800          CDS       T00010                                 

Symbol
opuCD
Name
(RefSeq) glycine betaine/carnitine/choline transport system permease protein OpuCD
  KO
K05846  osmoprotectant transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU33800 (opuCD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33800 (opuCD)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Osmoprotectant transporter
    BSU33800 (opuCD)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 937199
NCBI-ProteinID: NP_391260
Pasteur: BG12640
BSORF: BG12640
UniProt: O34742 A0A6M3ZGQ4
Position
complement(3467546..3468235)
AA seq 229 aa
MEVLQQLGTYYSQNGGYVLQEFYRHFLMSVYGVLFAAIVGIPLGILIARYRRLSGWVFAV
TNVIQTIPALAMLAVLMLVMGLGANTVILSLFLYSLLPIIRNTYTGIISIEHAYLESGKA
MGMTKFQVLRMVELPLALSVIMAGLRTALVIAIGITAIGTFVGAGGLGDIIVRGSNATNG
TAIILAGAIPTALMAVIADLVMGWLERALSPIKKKKGNFIIADRKTTSI
NT seq 690 nt   +upstreamnt  +downstreamnt
atggaagtactacagcagcttggcacatactattcgcaaaacggcggttacgtgctgcag
gaattttaccgccattttctgatgtcggtgtatggcgttttatttgccgccattgttgga
attccgctcggcatcctgatagccagatacagaagattaagcggatgggtttttgcggtc
acgaatgtcattcagaccatcccggctctcgccatgctcgccgtgctgatgcttgtcatg
gggctgggcgctaatacggtgatattgtcattatttctgtattctcttctgccgattatc
agaaatacgtatacagggattatcagtattgagcacgcctatcttgaatcgggaaaagca
atggggatgacaaaatttcaagtgctgcggatggtcgagcttccgcttgcgctttctgtc
ataatggccggcctgcgcaccgcgcttgtcattgcgatcggcattacggccatcgggaca
tttgtcggtgctggcggtctcggggacatcatcgtcagaggatcaaacgccacaaacgga
accgcgattatattagcgggagcgatccccacagctctgatggcggtgattgccgatttg
gtcatgggctggcttgaacgagcattaagcccgattaaaaagaaaaaaggaaattttatt
atagctgatagaaaaaccacctctatttaa

DBGET integrated database retrieval system