KEGG   Bacillus subtilis subsp. subtilis 168: BSU33810
Entry
BSU33810          CDS       T00010                                 

Symbol
opuCC
Name
(RefSeq) glycine betaine/carnitine/choline-binding protein OpuCC
  KO
K05845  osmoprotectant transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU33810 (opuCC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33810 (opuCC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Osmoprotectant transporter
    BSU33810 (opuCC)
SSDB
Motif
Pfam: OpuAC
Other DBs
NCBI-GeneID: 936248
NCBI-ProteinID: NP_391261
Pasteur: BG12639
BSORF: BG12639
UniProt: O32243 A0A6M4JRM8
Structure
Position
complement(3468253..3469164)
AA seq 303 aa
MTKIKWLGAFALVFVMLLGGCSLPGLGGASDDTIKIGAQSMTESEIVANMIAQLIEHDTD
LNTALVKNLGSNYVQHQAMLGGDIDISATRYSGTDLTSTLGKEAEKDPKKALNIVQNEFQ
KRFSYKWFDSYGFDNTYAFTVTKKFAEKEHINTVSDLKKNASQYKLGVDNAWLKRKGDGY
KGFVSTYGFEFGTTYPMQIGLVYDAVKNGKMDAVLAYSTDGRIKAYDLKILKDDKRFFPP
YDCSPVIPEKVLKEHPELEGVINKLIGQIDTETMQELNYEVDGKLKEPSVVAKEFLEKHH
YFD
NT seq 912 nt   +upstreamnt  +downstreamnt
atgacaaaaatcaaatggcttggcgcgtttgctctcgtctttgtcatgctgctaggcggc
tgctctctgccgggtctaggcggcgcttctgacgatacgatcaaaatcggggcgcagagc
atgacagaatcagaaattgtagcgaatatgatcgcgcagcttattgaacatgatacagat
ttgaatactgctttagtgaaaaacctcggctcaaactatgttcagcaccaagcgatgctg
ggcggtgacattgatatttcagccacgcgctattccggaacagatttaacaagcaccctc
ggcaaggaagcggagaaagatccgaaaaaagcgctgaacattgtgcagaacgagtttcaa
aagcgcttttcttataaatggtttgattcctacggctttgataacacatatgccttcacc
gtaacaaaaaagtttgcggaaaaggagcatattaacaccgtgtctgacctgaagaaaaat
gcttcccaatataaattaggcgtcgacaatgcttggctgaaacgaaaaggcgacgggtat
aaaggctttgtcagcacatatggctttgagttcggcacaacttatccaatgcagatcggg
ctagtctatgacgcagtcaaaaacgggaaaatggatgcggttttggcttattcaacggat
ggacggattaaagcatatgatctgaaaatcttaaaagacgataagcgtttctttccgccg
tatgactgttcaccggtgattccggaaaaggtgcttaaggagcatccggaacttgaaggt
gtgatcaataagctgattgggcaaatcgacacggaaacgatgcaggaacttaattatgag
gtggatggcaagctgaaggagccgtctgtcgtagcaaaggaatttttagagaaacatcat
tattttgactaa

DBGET integrated database retrieval system