KEGG   Bacillus subtilis subsp. subtilis 168: BSU33830
Entry
BSU33830          CDS       T00010                                 

Symbol
opuCA
Name
(RefSeq) glycine betaine/carnitine/choline transport ATP-binding protein OpuCA
  KO
K05847  osmoprotectant transport system ATP-binding protein [EC:7.6.2.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU33830 (opuCA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33830 (opuCA)
Enzymes [BR:bsu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.9  ABC-type quaternary amine transporter
     BSU33830 (opuCA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Osmoprotectant transporter
    BSU33830 (opuCA)
SSDB
Motif
Pfam: ABC_tran CBS AAA_21 AAA_22 AAA_16 AAA_24 AAA Rad17 SMC_N AAA_15 AAA_30 RNA_helicase tRNA_lig_kinase ATPase_2 AAA_28 Mg_chelatase RsgA_GTPase AAA_18 AAA_19 ATP-synt_ab G-alpha Orthopox_F6 AAA_5 AAA_29 AAA_23
Other DBs
NCBI-GeneID: 937136
NCBI-ProteinID: NP_391263
Pasteur: BG12637
BSORF: BG12637
UniProt: O34992 A0A6M3ZH14
Position
complement(3469860..3471002)
AA seq 380 aa
MLKLEQVSKVYKGGKKAVNSIDLDIAKGEFICFIGPSGCGKTTTMKMINRLIEPSSGRIF
IDGENIMEQDPVELRRKIGYVIQQIGLFPHMTIQQNISLVPKLLKWPEEKRKERARELLK
LVDMGPEYLDRYPHELSGGQQQRIGVLRALAAEPPLILMDEPFGALDPITRDSLQEEFKK
LQRTLNKTIVFVTHDMDEAIKLADRIVILKAGEIVQVGTPDEILRNPANEFVEEFIGKER
LIQSRPDIERVEQMMNRTPVTVSADKTLSQAIQLMREKRVDSLLVVDRQNVLKGYVDVEM
IDQNRKKASIVGDVYRSDIYTVQKGALLRDTVRKILKQGIKYVPVVDEQNHLAGIVTRAS
LVDIVYDSIWGDEENQLMTI
NT seq 1143 nt   +upstreamnt  +downstreamnt
ttgctgaaattggaacaagtgtcaaaagtatataaaggcggcaaaaaagctgtgaacagc
attgatttagatattgcaaaaggtgaatttatctgttttatcggcccgagcggctgcgga
aaaacgacgacgatgaagatgatcaacagactgatagaaccatcgtctggaaggatcttt
atcgacggagaaaatattatggaacaggacccggttgagctgaggagaaaaatcggctat
gtgatacagcagattggtttgttcccccatatgaccatccagcagaacatctcactcgta
ccaaagctgctgaaatggcctgaggaaaaacggaaagaacgggcgcgcgagctgttaaag
cttgtggatatgggcccagagtatttagaccgttatccgcatgagctcagcggcggacag
cagcagagaatcggcgtgctgcgcgccctggcagcggaaccccctctcattttaatggat
gaaccgttcggagcgcttgatccgattacgcgtgattcccttcaggaagaattcaaaaaa
ctgcagagaaccttaaacaaaacgattgtgtttgtaacccacgatatggatgaagcgatt
aagcttgctgacaggattgtgatattaaaagcgggagaaatcgttcaagtcggcacacct
gatgagattcttcgaaacccggcaaatgagtttgttgaagaatttatcgggaaagagcgc
ctgattcagtcaagaccggatatcgagcgggtagagcaaatgatgaacagaacgccggtg
acggtatctgcggacaaaacgctttctcaggcgattcagctgatgagagaaaaacgtgtt
gactcgctgctcgttgtggaccggcaaaacgtgctgaagggctatgttgatgtggaaatg
attgatcaaaaccgcaaaaaagcgagcatcgttggcgatgtataccgttcagatatatat
accgttcaaaaaggggcgcttcttcgcgatacagtccgaaaaattttgaagcaggggatc
aagtatgttccggtggtcgatgaacagaaccatttagcagggattgtgacaagagcgagc
ctcgttgatatcgtatacgattccatttggggcgacgaggaaaaccagctcatgacgatc
tga

DBGET integrated database retrieval system