KEGG   Bacillus subtilis subsp. subtilis 168: BSU33840
Entry
BSU33840          CDS       T00010                                 

Symbol
yvbF
Name
(RefSeq) HTH-type transcriptional regulator YvbF
  KO
K22301  HTH-type transcriptional regulator, osmoprotectant uptake regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU33840 (yvbF)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    BSU33840 (yvbF)
SSDB
Motif
Pfam: MarR_2 TrmB HTH_IclR Terminase_3C MarR HTH_24 HTH_27 HTH_5 HTH_Crp_2 SMC_ScpB DUF6262 KORA HTH_10 HTH_26 HTH_35
Other DBs
NCBI-GeneID: 936258
NCBI-ProteinID: NP_391264
Pasteur: BG14079
BSORF: BG14079
UniProt: O34709 A0A6M3ZG30
Position
3471266..3471823
AA seq 185 aa
MKKTALDIIEHAEEHLIEKIAENMHTFGMPSTVGRVLGIIYMNRKPMTLSELSEATGMSK
TRMSQVVREMIDANIAEKVFEKGVRKDLYDVEQDYYQTFISLFAANWTKVVSKNKVLYKK
LNRELSDLLQRDGLTPEAEEKVNQLLNELKEWLHYYDWLSRLIEFFESEEVFRYVPKTKE
CSSLK
NT seq 558 nt   +upstreamnt  +downstreamnt
gtgaaaaaaaccgctctcgacatcattgaacatgctgaagagcatctcattgagaagatt
gccgaaaatatgcatacgtttggaatgccttcaactgtcggacgtgtgctcggaattatt
tatatgaatcgaaaaccaatgaccttaagcgagctctctgaggcaacgggcatgagcaaa
acacggatgagccaggttgtccgggaaatgatcgatgccaatatcgccgaaaaggtgttt
gaaaaaggcgtacgaaaagacctttatgacgtcgagcaggattattatcaaaccttcatt
tctttatttgcggcgaattggacaaaggtcgtgagcaaaaacaaagtgctgtataaaaaa
ttaaaccgggagctgagtgatcttttacaaagggacgggcttaccccggaagcggaagag
aaagtcaatcagctgctgaatgaattaaaagaatggcttcattactatgattggctgagc
aggttgattgaattttttgagagtgaggaagtctttcggtatgtgccgaaaacaaaagaa
tgcagctctctaaaataa

DBGET integrated database retrieval system