KEGG   Bacillus subtilis subsp. subtilis 168: BSU33860
Entry
BSU33860          CDS       T00010                                 

Symbol
yvbH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: bPH_1 YvbH_ext Lsr2
Other DBs
NCBI-GeneID: 938639
NCBI-ProteinID: NP_391266
Pasteur: BG14081
BSORF: BG14081
UniProt: O32245 A0A6M3ZGR0
Position
3472626..3473240
AA seq 204 aa
MFKKIAADALGLSDIGKIIEPQDYDKTDADDYVMHEDNEKIYFLIKTKADEYCFTNLALI
HVDGERATSSKRTLKRYPYSQYKISDVFLETAGKVDLDVEIKFKLGGEQFDIDVHKDQIE
KLKDLYKALLRIAETTYENDILINQAEQSLDKAVTILHHTRPEHVNIETQYKELTEFGFT
WLTSVRSQYHIKDFGDVFEKYINN
NT seq 615 nt   +upstreamnt  +downstreamnt
atgttcaaaaaaattgcggcagatgccttgggcttatctgatatcggaaaaattatcgaa
cctcaggactatgacaaaacagacgcagatgactatgtcatgcatgaagataatgagaaa
atttatttcttgattaaaacaaaagcagacgagtattgctttacgaacctggccctgatc
catgtggacggcgaacgcgccacttcctcaaaacgaacgttgaaacgctatccttattcg
caatataaaatctctgacgtttttcttgaaactgccggaaaagtggatttggatgttgaa
attaagttcaagctgggcggtgaacaattcgacattgatgtccacaaagaccagattgaa
aagttaaaagacctttataaagcactgcttcgcatcgctgaaacaacctatgaaaatgac
attttaatcaatcaagcggagcaaagcttagataaagcagtgacgattcttcaccatacc
cgccctgagcacgtcaatattgaaacgcaatacaaagagctgaccgaattcggattcact
tggctgacatccgttcgctcgcagtatcatattaaggattttggggatgtatttgagaaa
tatattaataactag

DBGET integrated database retrieval system