KEGG   Bacillus subtilis subsp. subtilis 168: BSU33870
Entry
BSU33870          CDS       T00010                                 

Symbol
yvbI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: zf-ribbon_3 DZR zinc_ribbon_2 DZR_2 Yip1 zinc-ribbons_6 RecR
Other DBs
NCBI-GeneID: 938638
NCBI-ProteinID: NP_391267
Pasteur: BG14082
BSORF: BG14082
UniProt: O32246 A0A6M4JPA5
Position
3473372..3474070
AA seq 232 aa
MYCPQCGHQTDGGNFCEKCGSPLPGQSGHQHAAQTGAAAKQAAKQFGSFVLSVLKRPYQE
CKATGGEQLISAIITMVLFSLLTPLMFYILFSDGPGSVSFTAIFLEPTIYFILFLFGLHA
CIFFALKIAGNQVSFKDSFSRFGAFLIPFTAILILALFFFLLHTDICFTILAVGLIGAFF
AIPPAMLSSYQHSYKGKVDFIYSTIVIYLIICVTFQLIIEHYVKEIFRYMLF
NT seq 699 nt   +upstreamnt  +downstreamnt
atgtattgtcctcaatgcggccatcaaacagatggcggaaatttttgtgagaaatgcgga
tcaccgctccccggtcaatcaggccaccagcatgcagctcaaactggagccgctgcaaag
caagcagcaaaacagttcggttcatttgtcttatccgtcctgaaacgcccttatcaggaa
tgtaaagcaacaggcggagaacagctgatcagcgcaatcattacgatggttcttttcagt
ttgctgacccctttgatgttttatattcttttttcagacggtcccggaagcgtaagcttt
acagcaatcttcttagagccaaccatttattttattttatttctatttggcctgcatgca
tgcatctttttcgccctgaaaatcgcgggaaaccaagtgtctttcaaggattcattctca
agattcggagcatttcttattccttttacggctattttgattcttgcccttttcttcttt
ttattacatacagacatttgctttaccatattagccgttggtttaatcggtgcattcttc
gccattcctcctgcgatgctgagcagttaccagcattcatataaagggaaggttgatttc
atttactcaacgattgtgatttatctgatcatctgcgttacatttcagcttattatcgaa
cactatgtcaaagaaattttccgttatatgctcttttaa

DBGET integrated database retrieval system