KEGG   Bacillus subtilis subsp. subtilis 168: BSU33880
Entry
BSU33880          CDS       T00010                                 

Symbol
yvbJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: zinc_ribbon_2 DZR zf-ribbon_3 DUF6539 DZR_2
Other DBs
NCBI-GeneID: 938637
NCBI-ProteinID: NP_391268
Pasteur: BG14083
BSORF: BG14083
UniProt: O32247 A0A6M4JPA1
Position
complement(3474106..3475923)
AA seq 605 aa
MLFCKNCGSQNNEGAKFCKQCGTPIGGGSKQANQETASTAETRQAPRKPIPKKTIILWSS
IAAACVILFAAYKTGAYFTSKDRLVDKFEQAVNDGDQDQIATLLTPVNDNLKLTKNNVKP
FLTYLKDHPDKKDELFASLRDETAQKDIVYAEKDGKSLLVFDHYDLKVAPVYFEVSSNYK
NTDLYVNKEEAGSVKKADQAQTLGPYIPGEYTVSAKLKNDVVDLVKKEDIQAIGDSSFRV
DLSLEADDVTFSLANDIKSGKGDLLINGKSIHKDPFKSVTYGPLLTDGSMTASVEAEFPW
GKTKTAGVPIDDKEMELTLIPDQDTQEQIMNTIVKTTKQYSKALSDGNTAQMTEASANWK
AETKDTVDSMKSADSYLKDRYLETDFDLDTFALSQKNDGTWQVSVTGKELHQSSSYNDYT
KSEMTDDSPSYEYLLSYDKKQKKWIFEDAESTFESAGTNIKKIKNDKPETYTSAWAGSKN
KGSESSASGDVTDEQVTLFMGSYLQSQADAVNQNNFSLMEDSLEKGSSLYSDQQHLVSKL
NKEGTTEDFNNYEVKSWSQNGSAITIKTYEEFYITKSGGSPKLRTYNWTYTGVVKNGRIY
LTSIQ
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgttattttgtaagaattgcggctcccagaataatgaaggagccaagttttgtaaacaa
tgcggcaccccgatcggagggggcagcaaacaggcaaatcaagaaacagctagcactgca
gaaacgaggcaggctccgcgaaaaccgatccctaagaaaaccatcattttatggagcagc
attgccgcggcgtgcgttatattattcgccgcatataaaaccggagcgtattttacttca
aaggataggttagtagacaagtttgaacaggccgtaaatgatggggatcaggaccaaatc
gcgactctgcttacaccggtaaatgacaatcttaaactcactaaaaataatgtaaaaccg
tttcttacatatttgaaggatcatccagacaaaaaagatgaactttttgcatcgctgcgt
gatgaaacagcccagaaggatatcgtatatgcggaaaaagacgggaaaagcctgctggta
tttgaccattatgacttaaaggtagcacctgtttattttgaagtgagcagcaattataaa
aataccgatctatatgtcaataaagaggaagccggatctgtaaagaaagcagatcaagca
caaacccttggtccgtacattcccggcgaatatacagtctcagccaaactgaaaaacgat
gtcgttgaccttgtgaaaaaggaagacattcaggcgattggcgatagcagctttcgtgtt
gatctctcattggaagcagacgatgtgacattcagcttagcgaatgacatcaagagcggg
aagggagatttgctgattaacggtaaatcaattcataaagatccgttcaaatccgtaaca
tatggtccgctgctgacagatggatcaatgacagcttcagtcgaggcagaatttccgtgg
ggaaaaacaaaaactgccggcgttccgatcgatgataaagaaatggagttaacgttaatt
cctgatcaagatacacaggaacagattatgaacacaattgtcaaaacaacaaaacaatac
tccaaagctctatctgatgggaatacagcccagatgacagaggcaagtgccaattggaag
gcggagacgaaggacaccgtcgattctatgaaaagcgcggattcatacttaaaagataga
tacttggaaactgattttgacctggacacatttgccctctctcagaaaaacgacggaacg
tggcaggtatcggtaacaggaaaagaacttcaccagtcttcttcgtataacgactataca
aagtctgaaatgactgacgacagtccgagttatgaatatcttctttcatatgataaaaaa
cagaaaaagtggattttcgaagatgcagaatcaacattcgaatctgcaggcacaaatata
aagaaaatcaaaaatgataaaccagagacatacacttccgcctgggctggctcgaaaaac
aaaggcagtgaaagctctgcaagcggcgatgttacagatgaacaagtgacattatttatg
ggcagttatctgcaaagtcaggcagatgccgtgaatcaaaataatttctcactgatggaa
gacagccttgaaaaaggcagttccctttattccgaccagcagcatctcgtgtcgaaatta
aataaagaggggacaacagaagactttaataactatgaagtgaaaagctggagccaaaat
gggtcggctatcacgattaagacgtatgaagaattctatatcacaaaatcaggcggcagt
ccaaagctcagaacatataactggacctacaccggcgtagtgaagaacggaagaatttac
ttaacgtctattcaataa

DBGET integrated database retrieval system