KEGG   Bacillus subtilis subsp. subtilis 168: BSU33890Help
Entry
BSU33890          CDS       T00010                                 

Gene name
yvbK
Definition
(RefSeq) N-acetyltransferase YvbK
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_6 FR47 Acetyltransf_CG Acetyltransf_9 GNAT_acetyltr_2
Motif
Other DBs
NCBI-GeneID: 938642
NCBI-ProteinID: NP_391269
Pasteur: BG14084
BSORF: BG14084
UniProt: O32248
Structure
PDB: 

Position
3476043..3476510
Genome map
AA seq 155 aa AA seqDB search
MNMQKLRIELGEETNDELYDLLLLADPSKDIVDEYLERGECYTAWAGDELAGVYVLLKTR
PQTVEIVNIAVKESLQKKGFGKQLVLDAIEKAKKLGADTIEIGTGNSSIHQLSLYQKCGF
RIQAIDHDFFLRHYDEDIFENGIQCRDMVRLYLDL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgcaaaagctcaggattgaattaggagaagaaacaaatgacgaattatatgat
ctattgctgctcgccgatccatcgaaagacattgtagatgaatatcttgagaggggagaa
tgttacacagcttgggccggtgatgagcttgcaggggtttatgtattgctaaaaacaagg
ccgcaaacagttgaaattgtaaatattgcggtaaaagaatctcttcagaagaaaggcttt
ggcaaacagcttgtacttgacgccatcgaaaaagcgaagaagctgggggcggacacgatt
gaaatcggaacggggaattcgagcattcatcagctttccctctatcaaaaatgcggattc
cgcattcaggcgatcgaccacgatttctttctcagacattatgatgaggacatttttgaa
aacgggattcaatgccgcgatatggtaaggctttatttggatctctga

DBGET integrated database retrieval system