KEGG   Bacillus subtilis subsp. subtilis 168: BSU33890
Entry
BSU33890          CDS       T00010                                 

Symbol
yvbK
Name
(RefSeq) N-acetyltransferase YvbK
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_6 FR47 Acetyltransf_CG Acetyltransf_9 Acetyltransf_4
Other DBs
NCBI-GeneID: 938642
NCBI-ProteinID: NP_391269
Pasteur: BG14084
BSORF: BG14084
UniProt: O32248 A0A6M3ZGD4
Structure
Position
3476043..3476510
AA seq 155 aa
MNMQKLRIELGEETNDELYDLLLLADPSKDIVDEYLERGECYTAWAGDELAGVYVLLKTR
PQTVEIVNIAVKESLQKKGFGKQLVLDAIEKAKKLGADTIEIGTGNSSIHQLSLYQKCGF
RIQAIDHDFFLRHYDEDIFENGIQCRDMVRLYLDL
NT seq 468 nt   +upstreamnt  +downstreamnt
atgaatatgcaaaagctcaggattgaattaggagaagaaacaaatgacgaattatatgat
ctattgctgctcgccgatccatcgaaagacattgtagatgaatatcttgagaggggagaa
tgttacacagcttgggccggtgatgagcttgcaggggtttatgtattgctaaaaacaagg
ccgcaaacagttgaaattgtaaatattgcggtaaaagaatctcttcagaagaaaggcttt
ggcaaacagcttgtacttgacgccatcgaaaaagcgaagaagctgggggcggacacgatt
gaaatcggaacggggaattcgagcattcatcagctttccctctatcaaaaatgcggattc
cgcattcaggcgatcgaccacgatttctttctcagacattatgatgaggacatttttgaa
aacgggattcaatgccgcgatatggtaaggctttatttggatctctga

DBGET integrated database retrieval system