KEGG   Bacillus subtilis subsp. subtilis 168: BSU33900Help
Entry
BSU33900          CDS       T00010                                 

Gene name
eno
Definition
(RefSeq) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
bsu03018  RNA degradation
Module
bsu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bsu_M00002  Glycolysis, core module involving three-carbon compounds
bsu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU33900 (eno)
  09102 Energy metabolism
   00680 Methane metabolism
    BSU33900 (eno)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BSU33900 (eno)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsu03019]
    BSU33900 (eno)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU33900 (eno)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     BSU33900 (eno)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BSU33900 (eno)
Exosome [BR:bsu04147]
 Exosomal proteins
  Proteins found in most exosomes
   BSU33900 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-GeneID: 938641
NCBI-ProteinID: NP_391270
Pasteur: BG10899
BSORF: BG10899
UniProt: P37869
Structure
PDB: 

Position
complement(3476555..3477847)
Genome map
AA seq 430 aa AA seqDB search
MPYIVDVYAREVLDSRGNPTVEVEVYTETGAFGRALVPSGASTGEYEAVELRDGDKDRYL
GKGVLTAVNNVNEIIAPELLGFDVTEQNAIDQLLIELDGTENKGKLGANAILGVSMACAR
AAADFLQIPLYQYLGGFNSKTLPVPMMNIVNGGEHADNNVDIQEFMIMPVGAPNFREALR
MGAQIFHSLKSVLSAKGLNTAVGDEGGFAPNLGSNEEALQTIVEAIEKAGFKPGEEVKLA
MDAASSEFYNKEDGKYHLSGEGVVKTSAEMVDWYEELVSKYPIISIEDGLDENDWEGHKL
LTERLGKKVQLVGDDLFVTNTKKLSEGIKNGVGNSILIKVNQIGTLTETFDAIEMAKRAG
YTAVISHRSGETEDSTIADIAVATNAGQIKTGAPSRTDRVAKYNQLLRIEDQLAETAQYH
GINSFYNLNK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgccatacattgttgatgtttatgcacgcgaagtattagactcccgcggcaacccaaca
gttgaagttgaagtatatacagaaacaggagctttcggccgcgcattagtgccaagcgga
gcttctacaggtgaatacgaagcggttgagcttcgtgacggcgacaaagaccgttacctt
ggaaaaggcgtgttaacagctgttaacaacgtaaacgaaatcattgctccagagcttctt
ggctttgatgtaactgaacaaaacgcaatcgatcagcttttaatcgagcttgacggtact
gaaaacaaaggcaaacttggtgcgaacgcaatccttggcgtatctatggcttgtgcgcgt
gctgctgctgatttcttacagattcctctttaccaataccttggaggattcaactcaaaa
acgcttcctgtaccgatgatgaacatcgtaaacggcggagagcatgctgataacaacgtg
gatattcaagaattcatgatcatgcctgtaggtgctcctaacttccgtgaagcacttcgc
atgggcgctcaaatcttccacagcctgaaatcagtattaagcgcaaaaggcttaaacact
gctgtaggtgacgaaggcggattcgctccaaaccttggttctaacgaagaagcgcttcaa
acaatcgttgaagcaatcgaaaaagccggcttcaaacctggcgaagaagttaaacttgct
atggatgctgcatcttctgagttctacaacaaagaagacggcaaataccatctgtctggc
gaaggcgttgtgaaaacatctgctgaaatggttgactggtatgaagagcttgtttctaaa
tacccaatcatctcgatcgaagacggacttgacgaaaacgactgggaaggccacaagctt
cttactgagcgtcttggcaaaaaagttcagcttgttggtgacgacctcttcgttacaaac
acgaaaaaactttctgaaggtattaaaaacggcgtaggcaactctatcctgatcaaagta
aaccaaatcggtacattgactgaaacattcgatgcgatcgaaatggcgaaacgcgcaggc
tacacagctgttatctctcaccgttctggtgaaactgaagacagcacaatcgctgacatc
gctgtggcaacaaacgcaggacaaatcaaaacaggtgctccgtctcgtacggaccgtgtt
gcgaaatacaaccagcttcttcgcatcgaagatcagttggctgaaactgctcaataccac
ggtatcaactctttctacaacttaaacaagtaa

DBGET integrated database retrieval system