KEGG   Bacillus subtilis subsp. subtilis 168: BSU33910
Entry
BSU33910          CDS       T00010                                 

Gene name
pgm
Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K15633  2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00260  Glycine, serine and threonine metabolism
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bsu_M00002  Glycolysis, core module involving three-carbon compounds
bsu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU33910 (pgm)
  09102 Energy metabolism
   00680 Methane metabolism
    BSU33910 (pgm)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU33910 (pgm)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     BSU33910 (pgm)
SSDB
Motif
Pfam: iPGM_N Metalloenzyme Phosphodiest PglZ
Other DBs
NCBI-GeneID: 938574
NCBI-ProteinID: NP_391271
Pasteur: BG10898
BSORF: BG10898
UniProt: P39773 A0A6M3ZGR4
Position
complement(3477877..3479412)
AA seq 511 aa
MSKKPAALIILDGFGLRNETVGNAVALAKKPNFDRYWNQYPHQTLTASGEAVGLPEGQMG
NSEVGHLNIGAGRIVYQSLTRVNVAIREGEFERNQTFLDAISNAKENNKALHLFGLLSDG
GVHSHINHLFALLKLAKKEGLTKVYIHGFLDGRDVGPQTAKTYINQLNDQIKEIGVGEIA
SISGRYYSMDRDKRWDRVEKAYRAMAYGEGPSYRSALDVVDDSYANGIYDEFVIPSVITK
ENGEPVAKIQDGDSVIFYNFRPDRAIQISNTFTNKDFRDFDRGENYPKNLYFVCLTHFSE
TVDGYVAFKPINLDNTVGEVLSQHGLKQLRIAETEKYPHVTFFMSGGREAEFPGEERILI
NSPKVATYDLKPEMSAYEVKDALVKEIEADKHDAIILNFANPDMVGHSGMVEPTIKAIEA
VDECLGEVVDAILAKGGHAIITADHGNADILITESGEPHTAHTTNPVPVIVTKEGITLRE
GGILGDLAPTLLDLLGVEKPKEMTGTSLIQK
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgagtaaaaaaccagctgcactcatcattcttgatgggttcggattacgtaacgaaaca
gtagggaacgcagtcgctttagcgaaaaaaccgaattttgaccgctattggaaccagtat
cctcatcaaactttgactgcttcaggcgaggctgtaggtcttcctgaagggcaaatgggg
aactccgaagtaggtcacttaaatatcggtgcgggacgtattgtgtaccaaagcttaaca
cgcgtaaatgttgccattcgtgaaggagagttcgaacgcaatcaaacattccttgacgcg
atcagcaacgcgaaagaaaacaacaaagccttgcacctgttcggtcttttatctgacgga
ggcgtgcacagccatatcaatcatttattcgcactgttaaagcttgcgaaaaaagaaggg
ctgacaaaggtttatatccatggcttccttgacggccgtgatgtaggtccgcagacagcg
aaaacgtacatcaaccagttgaacgatcaaatcaaggaaatcggtgtaggtgaaatcgcc
agcatttccggacgttactactctatggaccgcgacaaacgctgggaccgtgtagaaaaa
gcgtaccgcgcaatggcgtacggcgaaggcccatcttaccgcagcgccctggatgttgtt
gatgattcatatgcaaatggtatctacgatgaattcgtgattccatctgtcatcacaaaa
gaaaacggtgagcctgttgcgaaaatccaagacggcgattctgtgattttctataatttc
agaccggaccgcgccatccagatttccaacacgttcacaaacaaagacttccgtgacttc
gaccgcggcgagaattatccaaagaacctgtatttcgtctgcctgactcacttcagtgaa
acagttgacggctatgtagcgtttaaaccgataaatcttgataacacagtcggagaagta
ttatctcagcacgggttaaaacagcttcgaattgcagaaactgaaaagtatccgcacgtc
acgttctttatgagcggcggccgtgaagctgaattcccgggtgaagagcgtattctcatc
aactcgcctaaagttgcaacgtatgacttgaagcctgagatgagtgcgtatgaagtgaaa
gacgcgcttgtcaaagaaattgaagctgacaagcatgacgcgatcattcttaacttcgca
aaccctgatatggtcggccactccggaatggttgaaccaacaattaaagcaattgaagca
gtggacgaatgcttgggcgaagtcgttgacgcgatccttgctaaaggcggacacgctatc
attaccgctgatcacggtaatgctgacattctgattacagaatcaggcgaaccgcacact
gcgcatacaacaaacccagtccctgtgattgtaacgaaagaaggcattacgctgcgtgaa
ggcggaatcctaggcgaccttgcaccaacgttattagaccttcttggtgttgaaaaaccg
aaagaaatgacaggaacatctttaattcaaaaataa

DBGET integrated database retrieval system