KEGG   Bacillus subtilis subsp. subtilis 168: BSU33920
Entry
BSU33920          CDS       T00010                                 

Symbol
tpiA
Name
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00051  Fructose and mannose metabolism
bsu00562  Inositol phosphate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bsu_M00002  Glycolysis, core module involving three-carbon compounds
bsu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU33920 (tpiA)
   00051 Fructose and mannose metabolism
    BSU33920 (tpiA)
   00562 Inositol phosphate metabolism
    BSU33920 (tpiA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU33920 (tpiA)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BSU33920 (tpiA)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BSU33920 (tpiA)
  Exosomal proteins of bladder cancer cells
   BSU33920 (tpiA)
  Exosomal proteins of melanoma cells
   BSU33920 (tpiA)
SSDB
Motif
Pfam: TIM
Other DBs
NCBI-GeneID: 938626
NCBI-ProteinID: NP_391272
Pasteur: BG10897
BSORF: BG10897
UniProt: P27876 A0A6M4JPA8
Position
complement(3479405..3480166)
AA seq 253 aa
MRKPIIAGNWKMNKTLGEAVSFVEEVKSSIPAADKAEAVVCAPALFLEKLASAVKGTDLK
VGAQNMHFEESGAFTGEISPVALKDLGVDYCVIGHSERREMFAETDETVNKKAHAAFKHG
IVPIICVGETLEEREAGKTNDLVADQVKKGLAGLSEEQVAASVIAYEPIWAIGTGKSSTA
KDANDVCAHIRKTVAESFSQEAADKLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEP
QSFVQLLEEGQYE
NT seq 762 nt   +upstreamnt  +downstreamnt
atgagaaaaccaattatcgccggtaactggaaaatgaacaaaacactcggcgaagctgtc
agcttcgttgaagaagtgaaatcttccattccagcagcagacaaagctgaagctgttgtt
tgcgcgccagcgcttttcttagaaaagcttgcttctgctgtgaaaggcactgacctaaaa
gtcggcgctcaaaacatgcacttcgaagaaagcggcgcgttcacaggcgaaatcagcccg
gttgctctgaaagaccttggcgttgactactgcgtcatcggccactctgagcgccgtgaa
atgttcgctgaaactgatgaaacagttaacaaaaaagcacacgcagctttcaaacacggc
attgtgccgatcatctgtgtaggtgaaacgcttgaagagcgtgaagccggcaaaacaaat
gatcttgttgctgaccaagtgaaaaaaggccttgctggtctttctgaagaacaagttgct
gcttctgttattgcgtatgagccaatctgggcaatcggaacaggcaaatcttctacagcg
aaagatgcgaatgacgtgtgtgcgcatatccgtaaaaccgtcgctgaaagcttcagccaa
gaagctgcagacaagcttcgcatccaatatggcggaagcgtaaagcctgcaaacattaaa
gaatatatggcagagtccgatattgacggtgctttggtcggcggcgcgagccttgagcca
cagtcattcgttcaattattggaggaaggtcaatatgagtaa

DBGET integrated database retrieval system