KEGG   Bacillus subtilis subsp. subtilis 168: BSU33930
Entry
BSU33930          CDS       T00010                                 

Symbol
pgk
Name
(RefSeq) phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bsu_M00002  Glycolysis, core module involving three-carbon compounds
bsu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU33930 (pgk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU33930 (pgk)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     BSU33930 (pgk)
Exosome [BR:bsu04147]
 Exosomal proteins
  Proteins found in most exosomes
   BSU33930 (pgk)
SSDB
Motif
Pfam: PGK
Other DBs
NCBI-GeneID: 938572
NCBI-ProteinID: NP_391273
Pasteur: BG11062
BSORF: BG11062
UniProt: P40924 A0A6M3ZH21
Position
complement(3480197..3481381)
AA seq 394 aa
MNKKTLKDIDVKGKVVFCRVDFNVPMKDGEVTDDTRIRAALPTIKHLADQGAKVLLASHL
GRPKGEVVEELRLTPVAARLGELLGKEVKKADEAYGDAVKAQISEMKDGDVLVLENVRFY
PGEEKNDPELAKAFAELADVYVNDAFGAAHRAHASTAGIAEHLPAVAGFLMEKELDVLGK
AVSNPDRPFTAIIGGAKVKDKIGVIESLLDKVDNLIIGGGLAYTFVKALGYEVGKSLLEE
DKIELAKSFMDRAKEKGVNFYMPEDVLVADDFSNDANVKIVPISEIPSDLEAIDIGTKTR
ETYADVIKNSKLVVWNGPMGVFEIDLFAQGTKAVAEALAEAKDTYSVIGGGDSAAAVEKF
GLADKMSHISTGGGASLEFMEGKELPGVAALNDK
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgaataaaaaaactctcaaagacatcgacgtaaaaggcaaagttgtattctgccgcgtt
gactttaacgttccaatgaaagacggggaagtaacagacgatacacgtatccgtgctgcg
cttccaacaatcaaacaccttgcagaccaaggcgcaaaagtccttcttgcgagccactta
ggccgcccgaaaggcgaagtggttgaggagcttcgtttaactcctgtcgctgcacgtctc
ggcgaactgcttggcaaagaagtgaaaaaagcggatgaagcatacggcgatgctgtaaaa
gcacaaatttctgagatgaaggacggagacgttcttgtattggaaaacgtacgtttctat
cctggtgaagagaaaaatgatcctgagcttgcaaaagcatttgctgagcttgcagatgta
tatgtaaatgacgcattcggtgctgcccaccgtgctcacgcatctacagctggaattgcc
gagcatctgccagcagttgcaggtttcttaatggaaaaagagcttgatgtacttggaaaa
gcggtttccaatcctgaccgcccgttcacagcgatcatcggcggagcgaaagtaaaagac
aaaatcggtgtaatcgaaagtcttcttgataaagtagacaacctgatcatcggcggaggt
cttgcttatactttcgtaaaagcgcttggctatgaagtcgggaaatctcttcttgaagag
gataaaatcgagcttgcgaaatcatttatggaccgcgctaaagaaaaaggcgttaacttc
tacatgcctgaagatgtactcgttgcagatgatttctctaacgatgcaaacgtgaaaatt
gtgccgatctctgaaatccctagtgatttagaagcaatcgacattggtacgaaaacacgc
gaaacgtatgctgacgtcatcaaaaacagcaaacttgtcgtgtggaacggaccaatgggc
gtattcgaaatcgacttgttcgctcaaggaacaaaagcggttgcggaagcattggcagag
gcgaaagatacatactctgtcatcggcggaggagactctgcggcagcggttgaaaaattc
ggccttgctgacaaaatgagccacatctcaacaggcggcggcgcatcccttgagtttatg
gaaggcaaagagcttccaggggtagctgcactgaacgataaataa

DBGET integrated database retrieval system