KEGG   Bacillus subtilis subsp. subtilis 168: BSU33950
Entry
BSU33950          CDS       T00010                                 

Symbol
cggR
Name
(RefSeq) central glycolytic genes regulator
  KO
K05311  central glycolytic genes regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU33950 (cggR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Other transcription factors
   Others
    BSU33950 (cggR)
SSDB
Motif
Pfam: Sugar-bind HTH_45 HTH_11 HTH_12
Other DBs
NCBI-GeneID: 938570
NCBI-ProteinID: NP_391275
Pasteur: BG14085
BSORF: BG14085
UniProt: O32253 A0A6M3ZGQ5
Structure
PDB: 
2OKG 3BXF 3BXE 3BXG 3BXH

Position
complement(3482752..3483774)
AA seq 340 aa
MNQLIQAQKKLLPDLLLVMQKRFEILQYIRLTEPIGRRSLSASLGISERVLRGEVQFLKE
QNLVDIKTNGMTLTEEGYELLSVLEDTMKDVLGLTLLEKTLKERLNLKDAIIVSGDSDQS
PWVKKEMGRAAVACMKKRFSGKNIVAVTGGTTIEAVAEMMTPDSKNRELLFVPARGGLGE
DVKNQANTICAHMAEKASGTYRLLFVPGQLSQGAYSSIIEEPSVKEVLNTIKSASMLVHG
IGEAKTMAQRRNTPLEDLKKIDDNDAVTEAFGYYFNADGEVVHKVHSVGMQLDDIDAIPD
IIAVAGGSSKAEAIEAYFKKPRNTVLVTDEGAAKKLLRDE
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgaaccagttaatacaagctcaaaaaaaattattgcctgatcttctgctcgttatgcaa
aagaggtttgaaatcttgcagtatatcaggctgacagaacccatcgggcgaagaagcctg
tctgccagtctcggaatcagcgagcgtgtgctgaggggcgaggttcagtttttaaaggaa
cagaacctggtcgatattaagacaaacggcatgacattgacagaagagggctatgaactg
ctttctgttttggaagatacgatgaaagatgttttaggtttgactcttttggaaaagaca
ttaaaagaacgtttaaatctaaaggatgccattatcgtatccggagacagcgatcaatcc
ccatgggtcaaaaaagaaatgggaagagcggctgtcgcatgtatgaaaaaaagattttca
ggcaaaaatatcgtcgctgtaactggcggtacgacaattgaagctgtcgccgaaatgatg
acgccggattctaaaaaccgcgagcttttgtttgtgcctgcaagaggcggtttaggcgaa
gacgtgaaaaaccaggcgaacaccatatgcgcgcatatggcggagaaggcttcaggcact
taccggcttttgtttgttccgggacagctgtcacaaggcgcctattcatctattattgaa
gagccttctgtcaaagaggtgctgaacaccattaaatcagcgagtatgctggttcacgga
atcggcgaagctaaaactatggctcagcgcagaaacacgcctttagaagatttaaagaaa
atagatgataacgacgcggtgacggaagcgttcggctactattttaacgcggacggcgaa
gtggttcacaaagtgcattctgtcggaatgcagctggatgacatagacgccatccccgat
attattgcggtagcgggcggatcatcaaaagccgaagcgatcgaggcttactttaaaaag
ccacgcaacacggttctcgtcacagacgaaggagccgcaaagaagttattaagggatgaa
taa

DBGET integrated database retrieval system