KEGG   Bacillus subtilis subsp. subtilis 168: BSU33960Help
Entry
BSU33960          CDS       T00010                                 

Gene name
araE
Definition
(RefSeq) arabinose-proton symporter
  KO
K02100  MFS transporter, SP family, arabinose:H+ symporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33960 (araE)
Transporters [BR:bsu02000]
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    BSU33960 (araE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 MFS_1_like TRI12 MFS_3
Motif
Other DBs
NCBI-GeneID: 938567
NCBI-ProteinID: NP_391276
Pasteur: BG11907
BSORF: BG11907
UniProt: P96710
Position
complement(3484072..3485466)
Genome map
AA seq 464 aa AA seqDB search
MKNTPTQLEPNVPVTRSHSMGFVILISCAAGLGGLLYGYDTAVISGAIGFLKDLYSLSPF
MEGLVISSIMIGGVVGVGISGFLSDRFGRRKILMTAALLFAISAIVSALSQDVSTLIIAR
IIGGLGIGMGSSLSVTYITEAAPPAIRGSLSSLYQLFTILGISATYFINLAVQRSGTYEW
GVHTGWRWMLAYGMVPSVIFFLVLLVVPESPRWLAKAGKTNEALKILTRINGETVAKEEL
KNIENSLKIEQMGSLSQLFKPGLRKALVIGILLALFNQVIGMNAITYYGPEIFKMMGFGQ
NAGFVTTCIVGVVEVIFTVIAVLLIDKVGRKKLMSIGSAFMAIFMILIGTSFYFELTSGI
MMIVLILGFVAAFCVSVGPITWIMISEIFPNHLRARAAGIATIFLWGANWAIGQFVPMMI
DSFGLAYTFWIFAVINILCFLFVVTICPETKNKSLEEIEKLWIK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatactccaactcaattagaaccaaatgttcctgtaacaagaagccattcaatg
ggatttgtcattttgatctcatgtgcggcggggcttggcggcttattgtatggctatgac
acggcagtgatttctggcgccatcggttttctgaaagatttatacagcctgagtccgttt
atggagggacttgtcatttcaagcattatgattggaggagttgtgggcgtcgggatatcc
ggatttttaagtgacagattcggccggagaaaaattttaatgacagccgctttgttattt
gcgatatcagcaatcgtttcagcgctttctcaagacgtgtccaccttaatcattgcaagg
attatcggggggctgggaatcgggatgggctcatcgctctctgttacgtatattacagaa
gcggcaccgcccgctatacgcggaagtttatcttcgttatatcagctctttacgatactg
ggtatttccgcaacatactttattaatctagctgtgcagcggtccggaacatacgaatgg
ggcgtgcacaccggctggagatggatgcttgcttatggaatggtgccatccgtcattttt
ttccttgtcctgctcgtcgtcccggaaagtccgagatggctggcgaaagcgggcaaaaca
aatgaagctttaaagatcctgacacgtattaatggagaaactgttgcaaaagaagaatta
aagaacattgagaactctttaaaaatagaacaaatggggtcgctctcccagctgtttaag
ccgggtctcagaaaggcgcttgtcattggaatcctgctggcgctgtttaaccaagtcatc
ggcatgaacgcgattacttactacgggccggaaatctttaaaatgatgggattcgggcaa
aacgccggatttgtgacgacttgtatcgtcggggttgtagaagttatttttaccgttatt
gcggtgttgctgattgataaagtcggacgaaaaaaactgatgtccatcggttctgctttt
atggctatttttatgattttaatcgggacgtcgttttattttgagttaacaagcgggatc
atgatgatcgtccttatattaggttttgtcgctgctttctgtgtctcggtcggaccgatc
acatggattatgatttctgaaatcttcccgaaccatctgcgtgcgcgggccgcgggcatt
gcgaccatctttttatggggagcaaactgggcgatcggacagtttgtgccaatgatgatc
gattctttcgggctcgcctatacattttggatctttgcggtgattaacatcctttgtttc
ctgtttgtcgttacgatctgtccagaaacgaagaacaaatcgctcgaggaaattgaaaag
ctttggataaaatga

DBGET integrated database retrieval system