KEGG   Bacillus subtilis subsp. subtilis 168: BSU33970
Entry
BSU33970          CDS       T00010                                 

Symbol
araR
Name
(RefSeq) transcriptional repressor
  KO
K02103  GntR family transcriptional regulator, arabinose operon transcriptional repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU33970 (araR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   GntR family
    BSU33970 (araR)
SSDB
Motif
Pfam: Peripla_BP_3 GntR Peripla_BP_1 Peripla_BP_4 HTH_DeoR HTH_11 MarR_2 RPA_C Rrf2 HTH_41 HTH_36 DUF977 PaaX
Other DBs
NCBI-GeneID: 938635
NCBI-ProteinID: NP_391277
Pasteur: BG11913
BSORF: BG11913
UniProt: P96711 A0A6M3ZG52
Structure
PDB: 

Position
3485604..3486758
AA seq 384 aa
MFSYKERCDILKFVRIHFGGMDMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFG
VSRHTIRKAIGDLVSQGLLYSVQGGGTFVASRSAKSALHSNKTIGVLTTYISDYIFPSII
RGIESYLSEQGYSMLLTSTNNNPDNERRGLENLLSQHIDGLIVEPTKSALQTPNIGYYLN
LEKNGIPFAMINASYAELAAPSFTLDDVKGGMMAAEHLLSLGHTHMMGIFKADDTQGVKR
MNGFIQAHRERELFPSPDMIVTFTTEEKESKLLEKVKATLEKNSKHMPTAILCYNDEIAL
KVIDMLREMDLKVPEDMSIVGYDDSHFAQISEVKLTSVKHPKSVLGKAAAKYVIDCLEHK
KPKQEDVIFEPELIIRQSARKLNE
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgttttcttacaaagaacgctgtgatatactgaaatttgtccgtatacattttggagga
atggatatgttaccaaaatacgcgcaagtaaaagaagaaatcagttcttggattaatcaa
ggcaaaatactgcccgatcaaaaaatccctaccgaaaacgaattaatgcagcaattcggc
gtcagccggcataccatccgcaaagcgatcggagacctcgtatcacaaggtctgctgtac
agcgtgcaaggcggaggcacctttgtcgcttcacgctctgctaagtcagcgctgcattcc
aataaaacgatcggtgttttgacaacttacatatcagactatattttcccgagcatcatc
agaggaatcgagtcctatttaagcgagcaggggtattctatgcttttgacaagcacaaac
aacaacccggacaatgaaagaagaggcttagaaaacctgctgtcccagcatattgacgga
ctcatcgtagaaccgacaaaaagcgcccttcaaaccccaaacatcggctattatctgaac
ttggagaaaaacggcattccttttgcgatgattaacgcgtcatatgccgagcttgccgcg
ccaagttttaccttggatgatgtgaaaggcgggatgatggcggcggagcatttgctttct
ctcggccacacgcatatgatgggtatttttaaagctgatgacacacaaggcgtgaaacgg
atgaacggatttatacaggcgcaccgggagcgtgagttgtttccttctccggatatgatc
gtgacatttacaacggaagaaaaagaatcaaaacttctggagaaagtaaaagccacactg
gagaaaaacagcaagcacatgccgacagccattctttgttataacgatgaaattgcgctg
aaggtgattgatatgctgagggagatggatcttaaagtgccggaggatatgtctattgtc
gggtacgatgattcacatttcgcccaaatctcagaagtgaaactaacctctgtcaaacat
ccgaaatcagtgcttggaaaagcagccgccaaatatgtcattgactgcttagagcataaa
aagccgaagcaagaggatgtcatatttgagcctgagttgatcattcgccagtccgcacga
aaactgaatgaataa

DBGET integrated database retrieval system