KEGG   Bacillus subtilis subsp. subtilis 168: BSU33980
Entry
BSU33980          CDS       T00010                                 

Symbol
yvbT
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Bac_luciferase
Other DBs
NCBI-GeneID: 938634
NCBI-ProteinID: NP_391278
Pasteur: BG14086
BSORF: BG14086
UniProt: O32254 A0A6M3ZGG8
Position
complement(3486807..3487817)
AA seq 336 aa
MSNNQRKDTLLSVLNLSPVVQGGTIAESFRNSMDLARRAEEWGYHRYWLAEHHNIEGVAS
SATAVLIGHIAGGTKKIRVGSGGIMLPNHSSLVIAEQFGTLETLYPGRIDLGLGRAPGTD
QLTARALRRNINSGEDFPEQLEELRNYFKPSGNVRNQVRAIPGEGIDVPIWLLGSSGFSA
RLAGELGLPFAFAAHFSPANTVPALELYRNSFTPSDVLDEPYAMVGVTIIAADTNEKAQH
LATSHYQRFLDLVRGTPNQLKPPVEDMDQIWSPYEKAMVNEQLSSTIVGGPEEVKAKLED
FVKTTQADEIMVNSETFEHADRMRSFEIIADVWKNR
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgtctaacaaccaacgcaaagataccttgctttctgtcttgaatttatctccggttgtt
cagggaggaacgattgcagaatcattccgaaacagcatggacttggcgcgccgggcagag
gaatggggctatcaccgttactggcttgctgaacatcataatatagaaggtgttgcaagc
tctgccaccgcagttttgattggccatattgccggaggcacgaagaaaatccgcgtcggt
tccggcggcattatgctccccaaccactcttcattagtcattgctgaacaattcggcaca
ctggaaacactgtatcccgggcggattgatctggggcttggacgtgcgccgggaacagac
caattgacagccagagcgctccgcagaaacatcaacagcggggaggattttccagaacaa
ttagaggaactgcgcaattattttaaaccgtcaggaaatgtgcgcaatcaagttcgcgcc
attcccggagagggcatagatgtgccgatttggctgctgggctcaagcggcttcagcgcc
cgtctggctggcgaacttggtcttccgtttgcgttcgcggcccatttctcaccggcgaat
acggttcccgctttggagctgtaccgcaattccttcacgccgtcagacgtgctcgacgaa
ccgtatgcgatggtcggtgtcaccattatcgcggcagatacaaacgagaaagcgcagcac
cttgcgacttcccattatcaaaggtttcttgatcttgtccgcggtacgcctaaccagctt
aaaccgcctgttgaggatatggaccaaatctggagcccgtatgaaaaagcgatggtcaat
gagcagctgagctccacgattgtcggaggtccggaagaagtgaaggcgaagcttgaagat
ttcgtcaaaacgacacaggctgacgaaattatggttaactcagaaacctttgaacacgca
gacagaatgcgttcgtttgaaatcatcgctgacgtttggaaaaacagataa

DBGET integrated database retrieval system