KEGG   Bacillus subtilis subsp. subtilis 168: BSU33990
Entry
BSU33990          CDS       T00010                                 

Symbol
yvbU
Name
(RefSeq) HTH-type transcriptional regulator YvbU
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: LysR_substrate HTH_1
Other DBs
NCBI-GeneID: 937711
NCBI-ProteinID: NP_391279
Pasteur: BG14087
BSORF: BG14087
UniProt: O32255 A0A6M3ZGE4
Position
complement(3487974..3488852)
AA seq 292 aa
MTITQLKVFVKIAETGSFTKAGQALNMTQPAVSHAISAIEAELDVKLIIRDRRNGLMLTD
TGKQILVHIREVLKGIEKVEQVAAAEKGLELGTIHIGTFSTASAYFMPKLISEFKQKYPK
LELVLHEGTVNEVKEWLHTRMIDVGILLYPTEEMEYIHLKKDKMAVVLRDDHPLASHSAI
TLKDLDHEPMIVCDGGYESPFIDMFRQAGATLHPAFTVYNINTSISMIREGLGLAILSEM
SMSGMPLPEHVVTRELDPQVYRDVQLAVPSLKEASLAAKLFIEMAKELFGAE
NT seq 879 nt   +upstreamnt  +downstreamnt
atgaccattactcaattaaaggtttttgtgaaaatagctgaaacgggaagctttacaaaa
gcgggtcaggcgctgaacatgacacagccggctgtcagccatgcgatttctgcgatcgaa
gctgagcttgatgtaaagctgatcattcgtgaccgccgcaatggcctgatgctgacggat
acgggaaaacagatcttagtacacatcagagaagtcttaaaaggcattgaaaaagttgag
caggtagcagcagcggaaaaagggcttgaactgggaacgatccatatcggcacattctca
actgcctcggcttattttatgccgaagctgatcagtgaatttaaacaaaaatatccgaaa
cttgagctcgtgctgcacgagggaactgtaaatgaagtcaaggagtggcttcatacgcgg
atgatagatgttgggattcttctgtatccaacagaggagatggagtacattcatttgaaa
aaagacaaaatggctgtcgtgctcagggacgatcacccgcttgccagtcattcagccatt
acgctgaaagatcttgaccatgaaccgatgatcgtctgtgacggcggctatgaatcacca
tttatcgatatgttcaggcaggcgggtgctacgctgcacccagctttcacggtctataac
atcaacacctcgatcagtatgatcagagaaggcctgggcctggccattttatcagaaatg
tccatgtcggggatgccgctgccagagcatgtggtgaccagggaattggacccgcaggta
taccgtgatgtgcagcttgctgttccgtcgctaaaggaggcttctctggcggctaagctc
tttattgagatggctaaggagttgtttggagcagaataa

DBGET integrated database retrieval system