KEGG   Bacillus subtilis subsp. subtilis 168: BSU34000
Entry
BSU34000          CDS       T00010                                 

Symbol
cyeB
Name
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: EamA
Other DBs
NCBI-GeneID: 936287
NCBI-ProteinID: NP_391280
Pasteur: BG14088
BSORF: BG14088
UniProt: O32256 A0A6M4JPB5
Position
3488952..3489869
AA seq 305 aa
MKQLPKTRTALLLAFLVIMWGVNWPLSKAALAYSPPLLFAGIRTLIGGLLLVIVALPRIH
KLRLKETWPIYLVSALLNITLFYGLQTIGLNYLPAGLFSAIVFFQPVLMGVFSWLWLGES
MFVMKVIGLILGFAGVAVISAAGFGGHISVIGVLLALGSAVSWALGTVYMKKTGSRVDSI
WMVALQLTIGSVFLLISGFWTESFSAIQWTAPFITSLLFISVFVIALGWLVFFTLVGSGE
ASKVASYTFLIPLISIVASSIFLHEPLTLSLLAGLLLIVTSICLVNTKSKAQKAAAIGIN
EKAAQ
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaagcagctcccaaaaacgcggacagctctcctgctcgcatttctcgtcatcatgtgg
ggcgtcaattggccgctgtccaaagccgcgctcgcctattctccgccattattgttcgcg
ggcatccgaacgctgatcggcgggcttttattagtcatagtcgcactgccgcgtattcat
aaattacgcttaaaagaaacgtggccgatttatcttgtttctgctcttttaaatattaca
ttattctacggcctgcaaacgatcgggctgaattatcttccggccggcctgttttctgca
atcgtcttcttccagcctgttctgatgggtgtattttcttggctgtggctcggcgaatcc
atgtttgtaatgaaagtgattggcctcatcctcggttttgcgggagtagccgtcattagt
gctgcgggctttggcgggcatatttctgtcattggggttctgctggctctcggctccgca
gtcagctgggcgctcgggacagtatatatgaaaaaaacaggcagccgcgtcgattccatc
tggatggtcgctctgcagctgacgatcggaagcgtgtttctgcttatctccggcttttgg
acagaaagcttttcggcgatccaatggacagctccgtttattacgagcctgctgttcatc
tccgtattcgttatcgcactcggctggcttgtcttttttacgcttgtcggttcaggagaa
gcaagcaaggtcgcatcttatacttttttgattccgctcatatcaatcgtggccagctcc
attttcctgcatgaaccgctcacccttagcctcttggcagggctgctgctgattgtcacg
agcatctgtctcgtgaatacaaaatcaaaagcgcagaaagctgcggcgattggtataaac
gagaaagctgcacaataa

DBGET integrated database retrieval system