KEGG   Bacillus subtilis subsp. subtilis 168: BSU34020
Entry
BSU34020          CDS       T00010                                 

Symbol
yvbX
Name
(RefSeq) glycosylase YvbX
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Glyco_hydro_18 LamB_YcsF Internalin_N
Other DBs
NCBI-GeneID: 937709
NCBI-ProteinID: NP_391282
Pasteur: BG14090
BSORF: BG14090
UniProt: O32258 A0A6M3ZKX2
Position
complement(3491655..3492689)
AA seq 344 aa
MKKWLIIAVSLAIAIVLFMYTKGEAKAAGMTVGYTTGDTASYNSLTKYHTYMNAIATDTF
AFEKNGQIIGDAPTKQLTYAKKKKIKTWAVISNYNDAIYDFDGDLASRVMSNKTAKKRFT
DQLITLAKKHSYYGINIDFEAVNPEDRAAYSNFIQYVSQALNKKHIKTMVSVPAKSADDK
NDDWSWPYDYAKIGKYADFVQVMTYDEHGIWGEPGSVASTNWIKSSLQFSVKKIKANKVI
MGIPAYGYDWDVKDGSTSTIREWNELKSLIKKQKAKPAFNKKSGSMTFSYVDKKKHKHVV
WYENEKTVQTKSHLAKQYKIAGVSVYALGNESESFWKAIRKGTK
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgaaaaaatggctgatcatagcggtttcactggcgattgcgattgttctgtttatgtat
acaaaaggagaagcgaaggcagccggtatgacagtaggctacacgactggggatacggct
tcatacaattctcttacgaaatatcatacatacatgaatgccatcgcaaccgatacattt
gcgtttgaaaaaaacggacaaatcattggcgatgccccaactaagcagctgacatatgcg
aaaaagaaaaaaatcaagacatgggctgtcatttcaaactataatgatgccatttatgat
tttgacggagatttagcgagtcgggtcatgagcaataaaacagcgaaaaaacgattcaca
gatcagttaattacactggccaaaaagcactcatattacggaatcaatatcgattttgaa
gcagtaaatccagaagaccgcgctgcatactcgaacttcattcaatatgtctcacaggct
ttgaataagaaacatattaaaacaatggtatccgttccggccaaaagcgccgatgataaa
aatgatgactggagctggccgtatgattatgcgaaaatcggcaaatatgccgacttcgta
caagtcatgacctacgatgaacacggcatttggggtgagccggggtcagtggcaagcaca
aactggatcaaaagctctctgcagttttcagtcaaaaagatcaaagccaataaagtcatc
atgggaatccctgcgtacggctatgactgggatgtaaaagacggaagtaccagcacaata
agggaatggaatgagctcaaatccctcatcaaaaaacaaaaagcaaagccggcattcaac
aaaaaatcaggctcgatgacgttttcttatgttgacaaaaagaagcataaacatgtcgtg
tggtatgaaaacgaaaaaaccgttcaaacgaaaagccatctggcaaagcaatataaaata
gcaggtgtttcagtttacgcattaggaaacgagtcagaatccttttggaaagccattcga
aaagggacaaaataa

DBGET integrated database retrieval system