KEGG   Bacillus subtilis subsp. subtilis 168: BSU34030
Entry
BSU34030          CDS       T00010                                 

Symbol
yvbY
Name
(RefSeq) lactate utilization protein C
  KO
K00782  L-lactate dehydrogenase complex protein LldG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    BSU34030 (yvbY)
SSDB
Motif
Pfam: LUD_dom
Other DBs
NCBI-GeneID: 937742
NCBI-ProteinID: NP_391283
Pasteur: BG14091
BSORF: BG14091
UniProt: O32259 A0A6M3ZH36
Position
complement(3492797..3493519)
AA seq 240 aa
MTKGTIQNQESFLNRIASSLGRERRTGGVAVPEWAHQPQYKTLEGYSADDLVTVLKNHCV
KIHTELIETDSTGLYDALREQVSRFSGGPVIIPKDPRFEEYGLKSLLTKDWPSEGTPVWE
WDADKGEENIKKAEQANVGITFSEITLAESGTVVLFSSKDIGRSVSLLPTTYIAIVPKSS
IVPRMTQASDIIRQNIANGVTVPSCINYITGPSNSADIEMDLVVGVHGPVKAAYILVSDR
NT seq 723 nt   +upstreamnt  +downstreamnt
atgacgaagggaaccattcagaatcaagagagctttttaaaccgaatcgcatccagcctg
ggccgtgaacgaagaacaggaggcgtggcagtccctgaatgggcgcatcagccgcaatat
aaaacacttgaaggttattcagcggatgacttagtcacagtgctcaaaaaccattgtgtc
aaaatccatacagagctgattgaaacggattcaaccggcctttacgatgccctgcgcgag
caagtcagccgcttttctggaggccctgtcatcattccgaaggacccccgctttgaagaa
tacggactgaaaagcctgctcaccaaggactggccgagtgaaggaacgccggtctgggag
tgggatgctgacaaaggcgaggaaaatattaaaaaagcggagcaagccaatgtagggatt
acattcagcgaaattacattggctgagtcggggacggttgtcctcttctcctcaaaagac
atcggccgctctgtcagccttttgccaacgacttatattgcgatcgtgccgaaatcaagc
attgtaccgagaatgacacaagccagtgatatcatccgccaaaacattgcgaacggtgtc
actgttccttcatgtatcaactacattaccggaccgagtaactcagccgacattgaaatg
gatttagttgtgggggtgcatggaccagtaaaggcagcatatattctcgtctctgaccgc
tga

DBGET integrated database retrieval system