KEGG   Bacillus subtilis subsp. subtilis 168: BSU34040Help
Entry
BSU34040          CDS       T00010                                 

Gene name
yvfW
Definition
(RefSeq) lactate utilization protein B
  KO
K18929  L-lactate dehydrogenase complex protein LldF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    BSU34040 (yvfW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LUD_dom DUF3390 Fer4_8 Fer4_10 Fer4_17 Fer4 Fer4_9 Fer4_7 Fer4_3 Fer4_18 Fer4_21 Catalase-rel Fer4_2 Fer4_6
Motif
Other DBs
NCBI-GeneID: 938159
NCBI-ProteinID: NP_391284
Pasteur: BG12448
BSORF: BG12448
UniProt: O07021
Position
complement(3493519..3494958)
Genome map
AA seq 479 aa AA seqDB search
MAMKIGTDAFKERVSQGIDNEFMRGAVSGAQERLRTRRLEAAEELGNWEEWRSLSEEIRQ
HVLENLDFYLGQLAENVAKRGGHVYFAKTAEEASSYIRDVIQKKNGKKIVKSKSMVTEEI
NLNEVLEKEGCEVVETDLGEYILQIDDHDPPSHIVAPALHKNKEQIRDVFKERLDYQHTE
KPEELVMHARAILRKKFLEADIGITGCNFAIADTGSVSLVTNEGNGRLVSTLPKTQITVM
GMERIVPSFSEFEVLVSMLTRSAVGQRLTSYITALTGPKLEGEVDGPEEFHLVIVDNGRS
NILGTEFQSVLQCIRCAACINVCPVYRHVGGHSYGSIYSGPIGAVLSPLLGGYDDYKELP
YASSLCAACSEACPVKIPLHELLLKHRQNIVEKEGRAPISEKLAMKAFGLGASSLSLYKM
GSKWAPAAMTPFTEDEKISKGPGPLKNWTQIRDFPAPHKSRFRDWFADRETSERTKEEQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaaaatcggtactgacgcttttaaagagcgggtatcacaggggattgataat
gaatttatgagaggcgctgtttcaggtgcacaggagcgtctgcggacgcggcgcctagag
gcagcagaagaactgggaaactgggaggagtggcgctcattatcagaggaaatcaggcag
catgtccttgaaaaccttgatttctatctcggacagcttgccgaaaatgtggcgaaaaga
ggcggacatgtctatttcgcgaaaacagcggaagaggcgtcttcctatattcgggatgtc
attcaaaagaagaacgggaagaaaattgtgaaatctaaatcaatggtcacagaggaaatc
aatctgaatgaggtgctggagaaggaaggctgtgaagtcgtagaaaccgatctcggcgag
tatattttgcagattgatgatcacgatccgccgtcacatatcgtagcgcccgctcttcat
aaaaataaagagcagatacgcgatgtgtttaaagaaagactggactatcaacatacagaa
aaaccggaagagctggtgatgcatgcgcgcgccattctccggaaaaagtttctggaagcg
gatatcggcattaccggctgtaacttcgccatcgctgacacgggttccgtcagccttgtg
accaatgaaggaaatggacggcttgtgagcaccttgccgaaaacacaaattaccgtcatg
ggaatggagcggattgtcccgtcattttctgaatttgaagtgctagtcagcatgctgact
agaagtgctgtcggacagcggctgacaagctatattacagctttgacgggtccgaagctg
gaaggtgaagtggacggtccggaagaattccatcttgtcatcgttgataatggacgatcc
aatatccttggaacggaattccagtctgtgctgcaatgtatccgctgtgccgcctgtatc
aatgtctgtcctgtgtaccgccatgtcggcggacattcatacggctcaatctactcgggg
ccgatcggagctgttttatcaccgttgctcggcggttatgacgattataaggagctgccg
tacgcatcttcactgtgcgctgcttgttcagaagcctgcccggtcaaaatcccgcttcat
gagctgctactcaagcatcgtcagaatatcgtcgaaaaagaaggcagggcgccgatcagt
gaaaagcttgcaatgaaagcattcggacttggcgcatcctccttatcgctttacaaaatg
ggctcaaaatgggcgccggccgccatgacgccttttacagaggacgaaaaaatttcgaaa
gggcccggcccgcttaaaaattggacccagattcgcgacttcccggcaccgcataaatcg
agattcagagactggtttgcggacagagaaacaagtgaacgcacgaaggaggagcagtga

DBGET integrated database retrieval system