KEGG   Bacillus subtilis subsp. subtilis 168: BSU34050
Entry
BSU34050          CDS       T00010                                 

Gene name
yvfV
Definition
(RefSeq) lactate utilization protein A
  KO
K18928  L-lactate dehydrogenase complex protein LldE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    BSU34050 (yvfV)
SSDB
Motif
Pfam: CCG
Other DBs
NCBI-GeneID: 936297
NCBI-ProteinID: NP_391285
Pasteur: BG12447
BSORF: BG12447
UniProt: O07020 A0A6M4JPD1
Position
complement(3494985..3495701)
AA seq 238 aa
MKVSLFVTCLVDMFQTNVGKATVELLERLGCEVDFPEGQICCGQPAYNSGYVHDAKKAMK
RMIETFQDSEYVVSPSGSCTTMFREYPHLFQDDPKWADKAKKLADKTYELTDFIVNVLGV
EDVGATLHTKATLHTSCHMTRLLGVRKEPMKLLSHVKGLQFTELPGKHNCCGFGGTFSVK
MAQISEQMVDEKVECVEETGAEVLIGADCGCLMNIGGRLGRKDKNVKVMHIAEVLNSR
NT seq 717 nt   +upstreamnt  +downstreamnt
atgaaagtctcactttttgtcacttgtcttgttgatatgtttcaaacaaatgtcggaaaa
gcaacggttgagctgctggagcggcttgggtgcgaggttgattttccagaagggcagatt
tgctgcggacagccggcttacaacagcggctatgtacatgacgccaaaaaagcaatgaaa
cggatgatcgaaacgtttcaggattccgaatatgttgtcagtccttcgggttcctgcaca
acgatgttccgggagtatccgcacctgtttcaggatgatccgaaatgggccgataaagcg
aaaaagctggcggataaaacgtatgaactgacagattttattgtgaacgtccttggggta
gaggatgtcggcgcgacccttcatacaaaagcgaccttacatacgtcgtgccatatgact
aggctgctgggtgttcggaaggagccgatgaagctgttgagccatgtgaagggcctgcag
tttacagagcttccgggcaaacataactgctgcggattcggaggaacgttctcagtcaag
atggcgcagatttctgagcagatggtcgatgaaaaagtcgaatgtgtggaggaaacggga
gcagaggtgctgatcggtgctgactgcggctgtttgatgaatatcgggggacggcttggc
cgaaaagataagaatgtcaaagtgatgcacatcgccgaagtgctcaacagcagataa

DBGET integrated database retrieval system