KEGG   Bacillus subtilis subsp. subtilis 168: BSU34070
Entry
BSU34070          CDS       T00010                                 

Symbol
yvfT
Name
(RefSeq) two-component sensor histidine kinase YvfU
  KO
K07778  two-component system, NarL family, sensor histidine kinase DesK [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU34070 (yvfT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU34070 (yvfT)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU34070 (yvfT)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU34070 (yvfT)
Protein kinases [BR:bsu01001]
 Histidine kinases
  NarL family
   BSU34070 (yvfT)
Two-component system [BR:bsu02022]
 NarL family
  DesK-DesR (membrane lipid fluidity regulation)
   BSU34070 (yvfT)
SSDB
Motif
Pfam: HisKA_3 HATPase_c HATPase_c_2 DivIC HATPase_c_3
Other DBs
NCBI-GeneID: 937702
NCBI-ProteinID: NP_391287
Pasteur: BG12445
BSORF: BG12445
UniProt: Q795K2
Position
complement(3496495..3497481)
AA seq 328 aa
MLLLFVAAYRQLFCSVGKASFTYWLIVQMAVILMYSVFYNITYIYLGFFPANFVGYYKEK
TNFNRAFCALIFILLFPCLYQFIANSVSLRELFSVLPFLVIMLISPFGIRSMFRRIELEA
KLAQANEQIKELSKREERVRIARDLHDTLGHTLSLLTLKSQLIQRLAASDPERTKLEAKE
METSSRSALKQVRELVSDMRTVTITEELVNIQHILRAGNITFQYEGADDFSVISPVTQNI
ISMCMREAVTNIIKHSKATHCAITISQFADKMRIVIRDDGKGAPKEKMFGNGLWGMEERL
MLIEGGLTVSDHNGTVVALTIPLIKKAE
NT seq 987 nt   +upstreamnt  +downstreamnt
atgctgctcctttttgtagcggcatatcgccagttattctgcagcgtgggcaaagcttcg
tttacatattggcttatcgtgcaaatggcggttattttgatgtatagtgtgttttacaat
atcacctatatatacttaggtttttttccggcaaactttgttggttattacaaagagaaa
acgaattttaaccgtgcgttctgcgctttaatctttatactgctttttccatgcctatac
caatttatcgcgaattcggtctcgcttcgggagcttttttctgttctcccgtttctcgtc
attatgctcatttctccattcggaattcgttctatgtttcggaggattgagcttgaagct
aagcttgcacaagccaacgaacagataaaagaactctctaaaagggaggaacgtgttcga
atcgcccgtgatcttcacgatactcttggccacaccctgtcgctgcttacattaaaaagc
cagctcattcagcggctggctgcatctgatccagaacggaccaagcttgaggcaaaagaa
atggaaaccagttcacgctccgcactcaagcaagttcgagagctggtttctgatatgaga
acggtcacgataacagaggagctcgtaaacattcagcacatattaagagcggggaacatt
acctttcaatacgaaggagccgacgacttttcagtgatatctcccgtcactcaaaatatt
atcagtatgtgtatgcgggaagccgtgactaacattatcaagcacagcaaagcaacccac
tgtgccatcaccatttctcaatttgctgacaaaatgaggatcgtaatacgggatgacgga
aagggagcgccgaaggagaaaatgtttgggaatggcctgtggggaatggaagaacggctc
atgctcattgaagggggattaacggtttcagaccataacggaacggttgtggcactgacg
attccgcttattaaaaaagcagaatga

DBGET integrated database retrieval system