KEGG   Bacillus subtilis subsp. subtilis 168: BSU34080
Entry
BSU34080          CDS       T00010                                 

Symbol
yvfS
Name
(RefSeq) transport permease YvfS
  KO
K01992  ABC-2 type transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU34080 (yvfS)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU34080 (yvfS)
SSDB
Motif
Pfam: ABC2_membrane_3 ABC2_membrane ABC2_membrane_2 PDR_CDR
Other DBs
NCBI-GeneID: 936302
NCBI-ProteinID: NP_391288
Pasteur: BG12444
BSORF: BG12444
UniProt: O07017 A0A6M4JPC3
Position
complement(3497614..3498351)
AA seq 245 aa
MNVLQKQSIAEMKRVLRNKYFVLWSLIMPIAFYYFFTNVVNTNVPDQRAWEAHYLMSMTV
FSVMGSSIMTLGIRMVQERSQGWAAFIRLTPLPDHIYLSAQMIGQSVIHVLSITVIFLFG
AIINDIALSPFEWMMSGLWILFGALPFLALGTLIGLMRKVETAAGISNVLYMLLALGGGM
WMPFEVMPDMMQSIGQWLPSYHFGSGAWELVRGGSPTWKNILILIAYMMLFMLLSKYIRR
KQEAV
NT seq 738 nt   +upstreamnt  +downstreamnt
gtgaacgtgctgcaaaagcaaagcatcgctgaaatgaaaagggtgcttaggaacaagtac
tttgtgctttggtctctgatcatgccgattgccttttattatttctttacaaatgtagtg
aataccaacgtccctgatcaacgtgcatgggaagcccattacctgatgtcgatgacagtc
ttcagcgtgatgggttcctctatcatgacgcttggcatccgaatggtacaagaacggtca
caaggctgggccgcctttatccgccttacgcctcttccggatcatatctatttatcagct
cagatgatcggccaaagtgtcattcacgttttatcaattaccgtcatatttctgttcggc
gcaatcatcaatgatattgccttgtcaccgtttgaatggatgatgagcggactgtggatt
ttgtttggcgcattgccttttttagcattaggcacactaatcggcctcatgagaaaagta
gaaacagcggccggaatcagtaatgtgctttatatgctgctggctttaggcggagggatg
tggatgccgtttgaggtcatgcctgacatgatgcagagcattggccagtggcttccgtct
tatcatttcgggagcggagcgtgggaacttgtccggggtgggagtccgacttggaaaaat
attctgatattaatcgcttatatgatgctcttcatgctactatctaaatatataagaaga
aaacaagaagcggtgtaa

DBGET integrated database retrieval system