KEGG   Bacillus subtilis subsp. subtilis 168: BSU34090
Entry
BSU34090          CDS       T00010                                 

Symbol
yvfR
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU34090 (yvfR)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU34090 (yvfR)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N SbcC_Walker_B AAA_15 AAA_22 AAA_23 AAA_29 Thymidylate_kin DUF4162 ATPase_2 AAA_11 DO-GTPase2 AAA_30 RsgA_GTPase AAA_16 AAA_27 AAA_5 STN AAA_19
Other DBs
NCBI-GeneID: 936748
NCBI-ProteinID: NP_391289
Pasteur: BG12443
BSORF: BG12443
UniProt: O07016 A0A6M4JPC8
Position
complement(3498352..3499257)
AA seq 301 aa
MMKEAVTVSNVTKHFQRKTAVNNISFSIEKGEIAAILGPNGAGKTTVVSMILGLLKPSEG
EIKLFNRVPDDQQVREKIGVMLQEVSVMPGLKVDEILELFRSYYPNPLSMKELVSLTALT
KEDLKTRAEKLSGGQKRRLSFALALAGNPELLILDEPTVGMDTSSRHRFWQTIHGLSDQG
KTIIFSTHYLQEADDAAQRILFFTEGQLVADGSPMQIRSRIQKQSVSFTLHSSESLERLS
CHPEVERVIHEHERTIIQTSNTDKVLALIFQENIHARDIRIEQATLDEAFRQLADGNREA
M
NT seq 906 nt   +upstreamnt  +downstreamnt
gtgatgaaagaagcagtaacagtaagcaacgtgacaaaacatttccagcgaaaaaccgct
gtaaacaacatcagcttcagtattgaaaaaggagaaattgcagccattctcgggccaaat
ggggcagggaagacgaccgtcgtctcgatgatattaggattgctgaaaccgagtgaggga
gaaatcaaactatttaaccgggttcccgatgatcaacaggttcgtgaaaaaataggtgta
atgcttcaggaagtaagtgtcatgccgggccttaaggtggatgaaatccttgaactcttc
cggagctattatccgaatccattgtccatgaaagaactcgtttcgttaacagcactcacc
aaagaagatttgaaaacaagagcagaaaaattatccggcggacaaaaacgccgtttgagc
tttgctttggctcttgccgggaacccggagctgcttatacttgatgaaccgacagtcggc
atggacacttcatcaagacaccgattctggcagaccattcacggactgtcggaccaagga
aaaacgattattttttcaactcattatttacaggaagcagatgatgccgcacagcgaatc
ctattttttactgaaggacagcttgttgcagacggctcaccaatgcaaatccgctcaaga
attcaaaaacagtctgtttcctttacgcttcattcaagtgaatcattggaaaggctgtct
tgtcacccggaagtcgagagagtgatccacgagcatgagagaaccatcatccagacatca
aatacagacaaagtgttggcgctgatctttcaagaaaacatacatgcacgggatattcga
attgagcaagcaacgctcgatgaggcatttcgccagctggctgacggcaacagggaggcg
atgtga

DBGET integrated database retrieval system