KEGG   Bacillus subtilis subsp. subtilis 168: BSU34100
Entry
BSU34100          CDS       T00010                                 

Symbol
rsbQ
Name
(RefSeq) sigma factor SigB regulation protein RsbQ
  KO
K19707  sigma-B regulation protein RsbQ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU34100 (rsbQ)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     BSU34100 (rsbQ)
SSDB
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Ndr Abhydrolase_4 Esterase Peptidase_S9
Other DBs
NCBI-GeneID: 935930
NCBI-ProteinID: NP_391290
Pasteur: BG12442
BSORF: BG12442
UniProt: O07015 A0A6M4JPC1
Structure
PDB: 
1WOM 1WPR

Position
3499541..3500350
AA seq 269 aa
MNEAILSRNHVKVKGSGKASIMFAPGFGCDQSVWNAVAPAFEEDHRVILFDYVGSGHSDL
RAYDLNRYQTLDGYAQDVLDVCEALDLKETVFVGHSVGALIGMLASIRRPELFSHLVMVG
PSPCYLNDPPEYYGGFEEEQLLGLLEMMEKNYIGWATVFAATVLNQPDRPEIKEELESRF
CSTDPVIARQFAKAAFFSDHREDLSKVTVPSLILQCADDIIAPATVGKYMHQHLPYSSLK
QMEARGHCPHMSHPDETIQLIGDYLKAHV
NT seq 810 nt   +upstreamnt  +downstreamnt
atgaacgaagcgattttgtctagaaatcatgtgaaggtgaaaggcagcggcaaagcatct
atcatgttcgcacctggttttggatgcgatcaaagcgtgtggaatgccgtggcacctgcc
tttgaagaagatcatcgggtgattttatttgattacgtcggttcgggacattcagatttg
cgcgcatatgacctgaatcgttaccagacacttgacggctatgcccaggatgttcttgat
gtttgtgaagctttagatctgaaggaaaccgtgtttgtgggtcactccgtcggggccttg
attgggatgcttgcatccatccgccgcccggagcttttttcccatctggtgatggtgggg
ccttctccttgctatttgaatgatccgcctgagtattacggaggatttgaagaggagcag
ctccttggcttgctggagatgatggagaaaaattatatcggctgggcgactgtatttgcg
gcaaccgttctgaatcagccagatcggcctgaaattaaggaagagcttgaaagccgtttt
tgttctactgatcctgtcattgcccgccaattcgcgaaagcggcgtttttttctgatcac
cgagaggatctttcgaaggtaacggttccctctcttattctccaatgtgcagatgatatc
atcgcacctgcaacagtaggtaagtatatgcatcagcatctgccttatagcagtctgaaa
caaatggaggctcgcggacattgccctcatatgagccatccagatgagacgatacagctg
atcggcgattatttaaaagcacacgtgtga

DBGET integrated database retrieval system