KEGG   Bacillus subtilis subsp. subtilis 168: BSU34120
Entry
BSU34120          CDS       T00010                                 

Symbol
ganB
Name
(RefSeq) arabinogalactan endo-1,4-beta-galactosidase
  KO
K01224  arabinogalactan endo-1,4-beta-galactosidase [EC:3.2.1.89]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU34120 (ganB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.89  arabinogalactan endo-beta-1,4-galactanase
     BSU34120 (ganB)
SSDB
Motif
Pfam: Glyco_hydro_53 Cellulase
Other DBs
NCBI-GeneID: 937086
NCBI-ProteinID: NP_391292
Pasteur: BG12440
BSORF: BG12440
UniProt: O07013 A0A6M3ZGT1
Position
complement(3501651..3502940)
AA seq 429 aa
MKSKVKMFFAAAIVWSACSSTGYAAAIEKEKHVSELRAEDLFVKKVEGMNKDFIKGADVS
SVIALENSGVTFYNTNGKRQDIFTTLKQAGVNYVRVRIWNHPYDSNGNGYGGGNNDVQKA
IEIGKRATANGMKVLADFHYSDFWADPAKQKVPKAWANLSFEAKKAKLYEYTKQSLQKMI
KEGVDIGMVQVGNETTGGFAGETDWTKMCQLFNEGSRAVRETNSNILVALHFTNPETAGR
YSFIAETLSKNKVDYDVFASSYYPFWHGTLQNLTSVLKAVANTYGKKVMVAETSYTYTAE
DGDGHGNTAPKSGQTLPYPISVQGQATAVRDVMEAVANTGKAGLGVFYWEPAWIPVGPKT
QIEKNKVLWETYGSGWASSYAAEYDPEDAGKWYGGSAVDNQALFDFNGHPLPSLQVFQYA
ESGHIPKKR
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgaaaagcaaagtgaaaatgttctttgcggctgccatcgtgtggagtgcatgtagttca
acaggatatgccgctgccattgagaaggagaagcacgtgtcagagcttcgggcagaggat
ctttttgttaaaaaagtagaggggatgaacaaggattttatcaaaggggcagatgtatcc
agcgttattgctttggaaaacagcggtgtcaccttttacaatacaaacggaaaacgccag
gatatctttacaactttaaaacaggctggggtcaactatgttcgcgtccgcatctggaat
cacccgtatgattcaaatggcaacgggtatggcgggggaaacaatgatgttcaaaaagcc
atcgaaatcggaaaaagagcgacagcgaacggaatgaaggtgctggccgactttcactac
tctgatttctgggccgatccagcgaaacaaaaggtgcccaaagcctgggcgaatctcagc
tttgaagcaaaaaaagcaaagctctatgagtatacgaaacaaagcctgcaaaagatgatc
aaggaaggcgttgacatcggcatggttcaggtcggaaatgaaacaacaggaggatttgcc
ggtgagactgattggacgaagatgtgccaattatttaatgaaggaagccgagcggtcagg
gagacaaattcaaatattttggtcgccctgcattttaccaatcctgaaacggctggaagg
tattcatttattgcagaaacactcagcaaaaacaaagtggattatgatgtgtttgctagc
tcctattatcctttctggcatggcacattacaaaatttgacctccgtgctgaaggctgtt
gccaatacgtacggcaaaaaagtcatggtggcggagacatcgtacacctataccgctgag
gatggcgatgggcatggaaatacagcaccaaaaagcgggcagacgttgccatatccaatt
tctgttcaaggccaggcaactgcagtaagagatgtaatggaggcagtggcgaatacgggc
aaagcaggacttggtgttttctactgggagccggcgtggattccagtcgggccgaagaca
cagatagagaaaaacaaagtgttatgggaaacatacgggtcagggtgggcgtccagctat
gctgctgaatacgaccctgaagacgccgggaagtggtatgggggaagtgctgtagataat
caagctttatttgattttaatggacacccgctgccttccttgcaggtgtttcaatatgcg
gagtcaggacatattccaaagaaacgctga

DBGET integrated database retrieval system