KEGG   Bacillus subtilis subsp. subtilis 168: BSU34130
Entry
BSU34130          CDS       T00010                                 

Symbol
ganA
Name
(RefSeq) arabinogalactan type I oligomer exo-hydrolase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BSU34130 (ganA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BSU34130 (ganA)
SSDB
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4350
Other DBs
NCBI-GeneID: 936313
NCBI-ProteinID: NP_391293
Pasteur: BG12439
BSORF: BG12439
UniProt: O07012
Position
complement(3503020..3505083)
AA seq 687 aa
MMSKLEKTHVTKAKFMLHGGDYNPDQWLDRPDILADDIKLMKLSHTNTFSVGIFAWSALE
PEEGVYQFEWLDDIFERIHSIGGRVILATPSGARPAWLSQTYPEVLRVNASRVKQLHGGR
HNHCLTSKVYREKTRHINRLLAERYGHHPALLMWHISNEYGGDCHCDLCQHAFREWLKSK
YDNSLKTLNHAWWTPFWSHTFNDWSQIESPSPIGENGLHGLNLDWRRFVTDQTISFYENE
IIPLKELTPDIPITTNFMADTPDLIPYQGLDYSKFAKHVDAISWDAYPVWHNDWESTADL
AMKVGFINDLYRSLKQQPFLLMECTPSAVNWHNVNKAKRPGMNLLSSMQMIAHGSDSVLY
FQYRKSRGSSEKLHGAVVDHDNSPKNRVFQEVAKVGETLERLSEVVGTKRPAQTAILYDW
ENHWALEDAQGFAKATKRYPQTLQQHYRTFWEHDIPVDVITKEQDFSPYKLLIVPMLYLI
SEDTVSRLKAFTADGGTLVMTYISGVVNEHDLTYTGGWHPDLQAIFGVEPLETDTLYPKD
RNAVSYRSQIYEMKDYATVIDVKTASVEAVYQEDFYARTPAVTSHEYQQGKAYFIGARLE
DQFQRDFYEGLITDLSLSPVFPVRHGKGVSVQARQDQDNDYIFVMNFTEEKQLVTFDQSV
KDIMTGDILSGDLTMEKYEVRIVVNTH
NT seq 2064 nt   +upstreamnt  +downstreamnt
gtgatgtcaaagcttgaaaaaacgcacgtaacaaaagcaaaatttatgctccatggggga
gactacaaccccgatcagtggctggatcggcccgatattttagctgacgatatcaaactg
atgaagctttctcatacgaatacgttttctgtcggcatttttgcatggagcgcacttgag
ccggaggagggcgtatatcaatttgaatggctggatgatatttttgagcggattcacagt
ataggcggccgggtcatattagcaacgccgagcggagcccgtccggcctggctgtcgcaa
acctatccggaagttttgcgcgtcaatgcctcccgcgtcaaacagctgcacggcggaagg
cacaaccactgcctcacatctaaagtctaccgagaaaaaacacggcacatcaaccgctta
ttagcagaacgatacggacatcacccggcgctgttaatgtggcacatttcaaacgaatac
gggggagattgccactgtgatttatgccagcatgctttccgggagtggctgaaatcgaaa
tatgacaacagcctcaagacattgaaccatgcgtggtggacccctttttggagccatacg
ttcaatgactggtcacaaattgaaagcccttcgccgatcggtgaaaatggcttgcatggc
ctgaatttagattggcgccggttcgtcaccgatcaaacgatttcgttttatgaaaatgaa
atcattccgctgaaagaattgacgcctgatatccctatcacaacgaattttatggctgac
acaccggatttgatcccgtatcagggcctcgactacagcaaatttgcaaagcatgtcgat
gccatcagctgggacgcttatcctgtctggcacaatgactgggaaagcacagctgatttg
gcgatgaaggtcggctttatcaatgatctgtaccgaagcttgaagcagcagcccttctta
ttaatggagtgtacgccaagcgcggtcaattggcataacgtcaacaaggcaaagcgcccg
ggcatgaatctgctgtcatccatgcaaatgattgcccacggctcggacagcgttctctat
ttccaataccgcaaatcacgggggtcatcagaaaaattacacggagcggttgtggatcat
gacaatagcccgaagaaccgcgtctttcaagaagtggccaaggtaggcgagacattggaa
cggctgtccgaagttgtcggaacgaagaggccggctcaaaccgcgattttatatgactgg
gaaaatcattgggcgctcgaggatgctcaggggtttgcgaaggcgacaaaacgttatccg
caaacgcttcagcagcattaccgcacattctgggaacacgatatccctgtcgacgtcatc
acgaaagaacaagacttttcaccatataaactgctgatcgtcccgatgctgtatttaatc
agcgaggacaccgtttcccgtttaaaagcgtttacggctgacggcggcaccttagtcatg
acgtatatcagcggggttgtgaatgagcatgacttaacatacacaggcggatggcatccg
gatcttcaagctatatttggagttgagcctcttgaaacggacaccctgtatccgaaggat
cgaaacgctgtcagctaccgcagccaaatatatgaaatgaaggattatgcaaccgtgatt
gatgtaaagacagcttcagtggaagcggtgtatcaagaagatttttatgcgcgcacgcca
gcggtcacaagccatgagtatcagcagggcaaggcgtattttatcggcgcgcgtttggag
gatcaatttcagcgtgatttctatgagggtctgatcacagacctgtctctctctccagtt
tttccggttcggcacggaaaaggcgtctccgtacaagcgaggcaggatcaggacaatgat
tatatttttgtcatgaatttcacggaagaaaaacagctggtcacgtttgatcagagtgtg
aaggacataatgacaggagacatattgtcaggcgacctgacgatggaaaagtatgaagtg
agaattgtcgtaaacacacattag

DBGET integrated database retrieval system