KEGG   Bacillus subtilis subsp. subtilis 168: BSU34140
Entry
BSU34140          CDS       T00010                                 

Symbol
ganQ
Name
(RefSeq) arabinogalactan oligomer transport system permease protein GanQ
  KO
K15772  arabinogalactan oligomer / maltooligosaccharide transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU34140 (ganQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU34140 (ganQ)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Arabinogalactan oligomer/maltooligosaccharide transport system
    BSU34140 (ganQ)
SSDB
Motif
Pfam: BPD_transp_1 Peptidase_M56
Other DBs
NCBI-GeneID: 937991
NCBI-ProteinID: NP_391294
Pasteur: BG12438
BSORF: BG12438
UniProt: O07011 A0A6M4JPC6
Position
complement(3505102..3505953)
AA seq 283 aa
MLADMKVRRYIRLLFSYLLLAFMAVIIVYPLLWTAGASFNPGNSLISTSIIPKHPTFDHY
KELFAGKESLQYVQWYVNSMKISLFTMAGSLLCVTFTAYAFSRFRFKGRKYALTLFLLLQ
MIPQFSALIALFVLAQILGMINSHWLLILLYIGGLIPMNTYLMKGYMDSIPMDLDESAKI
DGASSTRIFFQIILPLSKPMAAVVAMNGFTGPLGDFVLSSTILRTPESYTLPVGLFNLVN
DVMGASYTTFAAGALLISIPVAVIFIMLQKNFVSGLTAGGTKG
NT seq 852 nt   +upstreamnt  +downstreamnt
atgctggcagatatgaaagtcagaagatatatccgtctccttttctcttacttgttgcta
gcctttatggcggtcatcattgtttatcctctcctttggacggcaggcgcaagctttaat
cccggcaacagcttaatcagtacatccatcattccgaagcatccgacattcgatcattac
aaggaattatttgcgggcaaggaaagccttcaatatgtgcagtggtatgtcaactctatg
aagatcagcctgtttacaatggcagggtctttgctctgtgtgacgtttacggcctatgcg
ttttcgcgctttcggtttaaagggaggaaatacgctttaacgctctttttattgctgcag
atgattcctcagttttcagctttaattgccttgtttgtgctggcgcaaatcttgggaatg
atcaatagccactggctgctaatcttgctttatatcggcggcctgatcccgatgaatacg
tatttgatgaaagggtacatggattccattccgatggatttagacgaaagcgccaagatt
gacggagccagcagcaccagaatcttcttccagatcattctgccattatcaaaaccgatg
gcggcagtcgtggccatgaacggctttaccggtccgctcggagattttgtgctgtcctca
accatattgagaacgcctgaatcatatacattgcccgtcggtctattcaatttagtgaat
gatgtcatgggggccagctatacgacatttgcggccggagccctgcttatcagcataccg
gttgccgtcatctttattatgctgcaaaagaattttgtgtccggattaaccgcaggcgga
acgaagggctaa

DBGET integrated database retrieval system