KEGG   Bacillus subtilis subsp. subtilis 168: BSU34170
Entry
BSU34170          CDS       T00010                                 

Gene name
ganR
Definition
(RefSeq) HTH-type transcriptional regulator GanR
  KO
K02529  LacI family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU34170 (ganR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    BSU34170 (ganR)
SSDB
Motif
Pfam: Peripla_BP_3 LacI Peripla_BP_1 HTH_3 Peripla_BP_4 HTH_19 HTH_AraC HTH_23 HTH_24 HTH_38 HTH_40 TnsD HTH_Tnp_ISL3
Other DBs
NCBI-GeneID: 936331
NCBI-ProteinID: NP_391297
Pasteur: BG12435
BSORF: BG12435
UniProt: O07008 A0A6M4JPD4
Position
complement(3508659..3509651)
AA seq 330 aa
MATIKDIAQEAGFSISTVSRVLNNDESLSVPDETREKIYEAAEKLNYRKKTVRPLVKHIA
FLYWLTDKEELEDVYFKTMRLEVEKLAKAFNVDMTTYKIADGIESIPEHTEGFIAVGTFS
DEELAFLRNLTENGVFIDSTPDPDHFDSVRPDLAQMTRKTVNILTEKGHKSIGFIGGTYK
NPNTNQDEMDIREQTFRSYMREKAMLDERYIFCHRGFSVENGYRLMSAAIDTLGDQLPTA
FMIAADPIAVGCLQALNEKGIAIPNRVSIVSINNISFAKYVSPPLTTFHIDIHELCKNAV
QLLLEQVQDKRRTVKTLYVGAELIVRKSMN
NT seq 993 nt   +upstreamnt  +downstreamnt
atggcgacaattaaagatatcgcgcaggaagcgggattttcaatctcaaccgtttcccgc
gttttaaataacgatgaaagcctttctgttcctgatgagacacgggagaaaatctatgaa
gcggcggaaaagctcaattaccgcaaaaaaacagtaaggccgctggtgaaacatattgcg
tttttatattggctgacagataaagaagaattagaagatgtctattttaaaacgatgaga
ttagaagtagagaaactggcgaaagcattcaatgtcgatatgaccacttataaaatagcg
gatggaatcgagagcattcctgaacatacggaagggtttattgccgtcggcacattttca
gatgaagagctggctttcctcagaaatctcactgaaaacggcgtgttcatcgattcaact
cctgatcccgatcattttgactcggtaaggcccgatttggcacaaatgacaaggaagacg
gtaaacatcctgactgagaaggggcataagagcatcggttttatcggcggcacatacaaa
aatccgaataccaatcaggatgaaatggacatccgtgaacaaaccttcagatcctatatg
agggaaaaagccatgctggacgagcgctatattttctgtcatcgcggattctctgtagaa
aacggctaccgcctgatgtcagcagcgatcgacacattaggcgatcagcttccgactgct
tttatgattgcagcggacccgattgcagtgggctgtctgcaagccctgaacgaaaaagga
attgccataccaaacagggtaagcattgtgagtatcaacaacatcagcttcgcgaagtat
gtctcgcctcctctgacgacgtttcatattgatatacatgaattatgtaaaaacgctgtt
caattactgcttgaacaagtgcaggacaagagaagaacggtaaaaacattatatgtgggc
gcagaattaatcgtcaggaagagtatgaattaa

DBGET integrated database retrieval system