KEGG   Bacillus subtilis subsp. subtilis 168: BSU34180
Entry
BSU34180          CDS       T00010                                 

Symbol
yvfI
Name
(RefSeq) HTH-type transcriptional regulator LutR
  KO
K05799  GntR family transcriptional regulator, transcriptional repressor for pyruvate dehydrogenase complex
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU34180 (yvfI)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   GntR family
    BSU34180 (yvfI)
SSDB
Motif
Pfam: FCD GntR HTH_11 HTH_41 MarR_2 Rrf2 TrmB HTH_5 Fe_dep_repress DUF2250 DUF4423 HTH_IclR HTH_27 FeoC HrcA_DNA-bdg HTH_46 HTH_Crp_2 HTH_24 PaaX HTH_DeoR
Other DBs
NCBI-GeneID: 936332
NCBI-ProteinID: NP_391298
Pasteur: BG12434
BSORF: BG12434
UniProt: O07007 A0A6M4JPD0
Position
complement(3509831..3510490)
AA seq 219 aa
MIKNGELKPGDKLDSVQALAESFQVSRSAVREALSALKAMGLVEMKQGEGTYLKEFELNQ
ISQPLSAALLMKKEDVKQLLEVRKLLEIGVASLAAEKRTEADLERIQDALKEMGSIEADG
ELGEKADFAFHLALADASQNELLKHLMNHVSSLLLETMRETRKIWLFSKKTSVQRLYEEH
ERIYNAVAAGNGAQAEAAMLAHLTNVEDVLSGYFEENVQ
NT seq 660 nt   +upstreamnt  +downstreamnt
atgatcaaaaatggcgaattgaagccgggggataaactggactctgttcaggcgcttgct
gagagctttcaagtcagccgttcagcggttcgcgaagcactttctgcgctaaaagcgatg
gggcttgtcgaaatgaaacagggagaaggcacgtatctgaaggaatttgagctcaatcaa
atttctcagccgctctcagccgcccttctgatgaaaaaagaggacgtcaagcagctgctc
gaggtcagaaaactgcttgaaatcggcgtggcttcactagcggctgaaaaaaggacagaa
gcagatctcgaaagaattcaggatgcactaaaggaaatgggcagcattgaagcggacggg
gagctgggagagaaagcagactttgcatttcatcttgcgcttgcggacgcttctcaaaat
gaacttcttaaacacttgatgaatcacgtgtcatcattgctgctggaaacaatgagggaa
acgaggaaaatctggctgttttccaagaagacctccgttcagcggctgtatgaggagcac
gaacggatttacaatgctgtggctgccgggaacggtgcacaggcggaagccgccatgctg
gcgcatttgacgaatgtggaagatgtgctttcgggatatttcgaggaaaatgtgcaataa

DBGET integrated database retrieval system