KEGG   Bacillus subtilis subsp. subtilis 168: BSU34190
Entry
BSU34190          CDS       T00010                                 

Symbol
yvfH
Name
(RefSeq) L-lactate permease
  KO
K03303  lactate permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU34190 (yvfH)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU34190 (yvfH)
SSDB
Motif
Pfam: Lactate_perm
Other DBs
NCBI-GeneID: 936322
NCBI-ProteinID: NP_391299
Pasteur: BG11875
BSORF: BG11875
UniProt: P71067 A0A6M4JPD7
Position
3510780..3512471
AA seq 563 aa
MQWTQAYTPIGGNLLLSALAALVPIIFFFWALAIKRMKGYTAGLATLGIALIIAVLVYRM
PAEKALMSATQGAVYGLLPIGWIIVTSVFLYKITVKTGQFDIIRSSVLSITDDRRLQALL
IAFSFGAFLEGAAGFGAPVAISAALLVGLGFNPLYAAGICLIANTAPVAFGAIGIPITAV
EGPTGIPAMEISQMVGRQLPFLSVFIPLYLIIIMSGFRKALEIWPAILVSGVSFAVVQYL
SSNFLGPELPDVLSALVSMAALAVFLKWWKPKTTFRFAGEQESAASIETARTNPAAPAYR
GGQIFKAWSPFLLLTAMISVWGIPSVKSALTGHYEGSAVFLKWLNAVGEKLTFSPGVPFL
NNQIVNADGTPIEAVYKLEVLGSAGTAILIAAVLSKFITAISWKDWGTVFKETVQELKLP
ILTIASVVGFAYVTNSSGMSTTLGMTLALTGSMFTFFSPVLGWLGVFITGSDTSANLLFG
NLQKVTALSVGMDPVLSVAANSSGGVTGKMISPQSIAVACAAVGLAGKESDLFRFTIKHS
LFLLLLVCIITFLQHHVFSWMIP
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgcaatggacacaggcatatacgcctatagggggaaatttgctattatcagcgcttgcc
gcacttgtaccgattattttctttttttgggcactcgcgattaaacggatgaaggggtat
acagcaggcttggccacattggggatcgcccttatcattgctgtattggtttatcgtatg
ccggcggaaaaagcgctgatgtccgcgacacaaggagccgtatacggattgttgccgatc
ggctggatcattgtgacgtctgtttttttgtataaaatcactgtgaaaacgggacagttt
gatatcattcgcagctctgttctctcgattactgatgaccgacggcttcaagctctcttg
atcgctttttcattcggggcttttttagaaggggcagcaggcttcggagcgccggtcgcc
atttctgccgcgctgctggtcggtctcggctttaatcctctttatgctgcggggatctgt
ttgatcgccaatacggcgccggttgcctttggggcaattgggattccaattacagccgta
gaagggccgacagggattccggcgatggagatttcgcaaatggttgggcggcagctgccg
tttttatccgtatttattcctctttatttaatcatcatcatgagcgggttcaggaaagcc
ttggagatctggccggcgattctcgtatccggtgtttcctttgctgttgttcaatatctc
agttccaattttttagggcctgagctgcccgatgttttgtcagctcttgtttcaatggct
gcgcttgctgtgtttttgaaatggtggaagccgaaaacaacattccggtttgccggtgaa
caagagtcggccgcctcaattgaaacggcgcgcacaaatccggcggcgcctgcatacaga
ggcggacagatttttaaggcttggtcgccatttctgctgctgacggcgatgatttccgta
tggggcattccatctgtcaaatccgcgctgaccgggcattatgaaggctctgcggtgttc
ttgaagtggctgaatgctgttggagaaaaactgactttttcccccggtgtgccttttttg
aacaatcagattgtcaatgctgacggtacgccgattgaagcggtttacaagttggaggtg
cttggttcggccggcaccgcgatattgattgccgcagtgctgtcaaaattcatcacggcg
atttcgtggaaagactggggaaccgtttttaaagaaacagtccaggaattgaagcttccg
attttgaccattgcttctgtcgttggttttgcctatgtcaccaactcctcgggaatgagc
acgacactcgggatgacactcgcgctgacaggttcgatgtttaccttcttttcgcccgtt
ctcggctggctcggcgtcttcattaccggctcggatacttctgccaacctgctgttcggc
aacctgcagaaagtcaccgcattatcagtcggcatggaccccgttctgtctgtggccgcc
aactcttcaggcggtgtcacaggaaaaatgatttcaccgcagtcgatagcggtggcgtgc
gccgcggtaggactcgccggaaaggagtcagatcttttccgctttaccattaaacacagt
ctgtttttgctgctgctcgtctgtatcatcacctttttgcagcatcacgtattcagctgg
atgattccttaa

DBGET integrated database retrieval system