KEGG   Bacillus subtilis subsp. subtilis 168: BSU34200Help
Entry
BSU34200          CDS       T00010                                 

Gene name
sigL
Definition
(RefSeq) RNA polymerase sigma-54 factor
  KO
K03092  RNA polymerase sigma-54 factor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU34200 (sigL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU34200 (sigL)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BSU34200 (sigL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_DBD Sigma54_CBD Sigma54_AID HTH_17 HTH_23 DUF1631 DUF1425 HTH_IclR HTH_Crp_2 HTH_38
Motif
Other DBs
NCBI-GeneID: 936362
NCBI-ProteinID: NP_391300
Pasteur: BG10748
BSORF: BG10748
UniProt: P24219
Position
complement(3512498..3513808)
Genome map
AA seq 436 aa AA seqDB search
MDMKLQQVQVLKPQLTQELRQAITLLGYHSAELAEYIDELSLENPLIERKETDTPPLSYH
KTNKNRMNAQEAGLQLSNPQKTLQDALKQQSLDMNLTNTEKKIFNYLIHSLDSNGYLEED
IEEAARRLSVSAKEAEAVLAKLQSLEPAGIGARSLQECILLQLQRLPNRNEQAEMLVSAH
FDAFAQKKWKTLSVETGIPLHTIQDISDDIAALHPRPGLLFARPEQDVYIEPDIFITVKN
GHIAAELNTRSFPEIDLHPQYRTLLSSGSCQDTVSYLSAKYQEWRWLSRALRQRKQTITR
IINELITRQKDFFLKGRSAMKPLTLREVADCLSLHESTVSRAIKGKTIQTPYGLFEMKLF
FSAKAEASGDGDASNYAVKTHLENLINQEDKTKPLSDQKLVDLLYEQHGIQISRRTVAKY
RDQMNIPSSAARKRYK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggatatgaaacttcagcaagtacaagtattaaagcctcaactgacacaggagctcagg
caggccatcacgctgcttggctatcattcggcagaactcgccgagtacattgatgagctc
tcactggaaaaccctcttattgaacgaaaggaaacagacacaccgccactatcttaccat
aaaacaaacaaaaacaggatgaatgcacaggaagcgggccttcaattaagtaatccgcaa
aaaacattgcaggatgcgttaaaacagcagtcactcgatatgaatctgacaaacactgaa
aaaaagatttttaattatctgattcattcgcttgattcaaacgggtacttggaagaagat
atagaggaggcagcacggcgattatctgtatcggccaaggaagcggaggctgttttggca
aaactccagtcgttagaaccggctggaatcggcgcgagatctttgcaggaatgcatcctt
cttcaattacagcggctgccgaacagaaatgaacaagcggaaatgctggtttcagctcat
tttgatgcttttgcgcaaaaaaaatggaaaacgctttcagtagagacgggaattccgctt
cataccattcaagatatctcagatgatatcgcggctcttcatcctagacctggccttctg
tttgcccggccagagcaagatgtgtatattgagcctgacatttttatcaccgtaaaaaat
gggcacatcgcagcggaactgaatacccgctcgtttcccgagatcgatctgcatccgcag
tacagaacgcttttatcatccggctcctgtcaggatactgtctcctatttatctgcgaaa
tatcaggagtggcgctggctgagccgcgcgctgcggcagcgaaaacagacaatcacgaga
attatcaatgaactgatcacacgccaaaaggatttctttctgaaagggcgaagcgcaatg
aagccgctgactctcagagaggtggcagactgtctaagccttcatgaatcaactgtgagc
cgggccattaaagggaaaacaatacaaacgccttacgggctgtttgagatgaaactcttt
ttctcagcaaaagccgaggcttcaggtgatggagatgcgtcgaattatgcagtcaaaacg
catctggaaaacctgatcaatcaagaggacaaaacaaaaccgctttcagaccaaaagctt
gtcgatttgctgtatgaacaacacggcatccaaatctcgagacgcaccgtggcaaaatat
cgcgatcaaatgaatattccgtcatcggcagcgagaaagcgatataaataa

DBGET integrated database retrieval system