KEGG   Bacillus subtilis subsp. subtilis 168: BSU34210
Entry
BSU34210          CDS       T00010                                 

Symbol
yvfG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YvfG Met_10 ALIX_LYPXL_bnd Ty3_capsid
Other DBs
NCBI-GeneID: 936336
NCBI-ProteinID: NP_391301
Pasteur: BG11876
BSORF: BG11876
UniProt: P71066 A0A6M4JPD9
Structure
PDB: 
2GSV 2JS1

Position
3513887..3514105
AA seq 72 aa
MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLD
EAYNKVKRGESK
NT seq 219 nt   +upstreamnt  +downstreamnt
atgtctgaacttttttccgtcccttattttattgagaatttaaaacagcatattgaaatg
aatcagtctgaggataaaatccacgcgatgaacagctactaccgttccgtcgtctcaaca
ctagtgcaggaccagctgacgaaaaacgcagttgtcctgaaacggattcagcatttagat
gaagcatacaacaaagtcaaacgtggagaatcaaaataa

DBGET integrated database retrieval system