KEGG   Bacillus subtilis subsp. subtilis 168: BSU34220Help
Entry
BSU34220          CDS       T00010                                 

Gene name
epsO
Definition
(RefSeq) pyruvyl transferase EpsO
  KO
K19431  pyruvyl transferase EpsO [EC:2.-.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU34220 (epsO)
Enzymes [BR:bsu01000]
 2. Transferases
  2.-  
   2.-.-  
    2.-.-.-  
     BSU34220 (epsO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_pyruv_trans
Motif
Other DBs
NCBI-GeneID: 936339
NCBI-ProteinID: NP_391302
Pasteur: BG11874
BSORF: BG11874
UniProt: P71065
Position
complement(3514115..3515083)
Genome map
AA seq 322 aa AA seqDB search
MDSKHSMISLKQKLSGLLDVIPKQSEIIYADYPLYGNVGDLFIMKGTEAFFKEHGIRVRK
RWNPDNFPIGRKLDPNLIIVCQGGGNFGDLYPYYQGFREKIVQTYPNHKIVILPQSIYFQ
NKDNLKRTAEIFSKHANLHIMTREKASYATAQAYFTTNHIQLLPDMAHQLFPVIPTQQPS
NQKLRFIRTDHEANQALQEHAEAESYDWRTVLSASDRRTIAFLQTLNVLNKKAGNPLPIA
YIWEKYSDYIVQKAIRFFSRYESVETSRLHGHILSSLLQKENTVIDNSYGKNANYFHTWM
EGVPSTRLIQHASKKENLPAHM
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaagcattcgatgatcagcctgaaacagaaactgtccgggctgctcgacgtc
attccgaaacaatcagagattatatatgctgactatcctctatatgggaatgtaggggat
ttatttattatgaaaggaacagaagccttctttaaagaacacgggattcgggtcagaaaa
cgctggaatccagacaatttcccaatcgggcgaaagcttgatccgaatctcatcatcgtc
tgccagggaggcggaaacttcggggatctgtatccgtattatcaaggctttagagagaaa
atcgtccaaacctatccgaaccacaaaattgtgatcctgccgcaatcgatttattttcaa
aacaaagacaacctcaagcggacggcagagatattttctaagcatgcgaaccttcacatc
atgacaagggaaaaagcctcctatgctacggcacaggcctattttacaacaaatcacatt
cagcttctgcctgatatggctcatcagctgtttcccgtcattcccacgcagcagccgtcc
aatcaaaagctgagatttatccgaacagatcatgaagcaaaccaggcgcttcaggaacac
gcagaagcggaaagctacgactggcgcacggtgctgtcagcttcagaccgccggacgatt
gcttttctccaaacgctgaacgtcttgaataaaaaagcaggcaaccctttgcccattgcg
tatatatgggaaaaatactcggattatatcgtccaaaaagcgattcggtttttcagccgt
tacgaatcggtggaaacatcaaggctgcacggccacatcctgtcttctcttcttcaaaaa
gaaaacacggtcattgataattcctacgggaaaaacgccaattactttcatacctggatg
gaaggcgtgccaagcacccgtctcatccagcacgcctcaaagaaggaaaaccttcctgct
cacatgtga

DBGET integrated database retrieval system