KEGG   Bacillus subtilis subsp. subtilis 168: BSU34240
Entry
BSU34240          CDS       T00010                                 

Symbol
epsM
Name
(RefSeq) acetyltransferase EpsM
  KO
K19429  acetyltransferase EpsM [EC:2.3.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU34240 (epsM)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     BSU34240 (epsM)
SSDB
Motif
Pfam: PglD_N Hexapep
Other DBs
NCBI-GeneID: 936372
NCBI-ProteinID: NP_391304
Pasteur: BG11872
BSORF: BG11872
UniProt: P71063 A0A6M3ZG70
Position
complement(3516233..3516883)
AA seq 216 aa
MKNVAIVGDGGHGKVIRELINARSDTRLAAVLDDKFKTFEGGKEWYTGPPKAVTELRRLI
PDVLFLIAVGNNSVRKQLAERLGLGKDDFITLIHPSAIVSKSAVIGEGTVIMAGAIIQAD
ARIGAHCIINTGAVAEHDNQISDYVHLSPRATLSGAVSVQEGAHVGTGASVIPQIIIGAW
SIVGAGSAVIRSIPDRVTAAGAPARIISSIQTSNKG
NT seq 651 nt   +upstreamnt  +downstreamnt
atgaaaaatgtggccattgtgggtgacggcggtcacggaaaggtgatcagagagctgata
aacgcccgctcagatacgcgcttagccgcggtgctggatgataaattcaaaacgttcgaa
ggcggaaaagaatggtacacaggaccgccgaaagccgttactgaactgcgcaggctcatt
cctgatgtgctgtttctgattgctgttgggaataacagtgtcagaaaacagctggcggag
cgactgggactggggaaagatgattttattacattgattcacccgtcagccatcgtcagc
aagtcggctgtcattggggaagggacagtgattatggcgggcgcgatcattcaggcggat
gcgcgcatcggcgcccactgcatcatcaatacgggtgcagtggcagagcacgacaatcaa
atcagcgattacgttcatctgtccccgcgtgccacgctgtcaggagcggtttccgttcag
gaaggcgctcacgtcggaaccggtgcatccgtcataccgcagatcataatcggggcttgg
agcattgtcggagccggctccgcggtgatccgttccataccggacagggtaacggcggcc
ggtgctccggcacgcatcatttcttccattcaaacatcaaacaaaggatga

DBGET integrated database retrieval system